CL

Technical Lead, Full Stack Engineer

ClassWallet

USremote countryPosted Aug 12, 2026
Posting intelligenceActively listed

Skills

programmaticpostgreskubernetesjavascripttypescriptplaywrightterraformmongoexpressfastifydatadogcypressnextnodedockergithubkafkamysqlreactcicdjestaws

About the role

ClassWallet, a leading financial technology company in the United States serving agencies delegated responsibility to manage public funds, is seeking to hire a Technical Lead, Full Stack Engineer to join our team.

Agencies use ClassWallet to get public funds to the right people, and ensure the funds are used for the right purpose. ClassWallet's suite of products and services empowers agency administrators to dramatically increase efficiency of funds distribution and spend compliance, reduce programmatic costs, maximize the full potential impact of the program, and satisfy the needs and expectations of policymakers, constituents and public reporting. ClassWallet has processed over $6.7 billion to date and serves public agencies across 39 states. In its 11+ years in operation, ClassWallet has completed over 12M transactions, funded 1.1M recipients, processed over 5M applications, and now serves 300+ state and local agency clients, supported by a team of 280+ full-time staff.

The Company has developed an industry-defining digital wallet solution which has gained rapid traction among state and local agencies and school districts across America. ClassWallet ranks as the 61st fastest growing software company on the prestigious Inc. 5000 list of fastest-growing private companies and the 21st fastest growing financial technology company on the Deloitte Technology Fast 500 in 2023.

While the Company delivers immense business value, the social impact of ClassWallet is a fabric that runs through its mission and corporate culture. As a result of ClassWallet’s innovation, public programs run with exponentially more efficiency and the impact and breadth of the programs for the individuals they serve is dramatically higher. This mission complements the Company's mission-based culture with focus on gratitude and work-life balance.

About the Role

Core Services builds the foundation the rest of ClassWallet's platform is built on and the new products that run on top of it. It's a small team that owns both the specification and the delivery of the reusable standards, services and components that multiple applications, built by independent teams, depend on to move quickly.

You'll build customer-facing applications on a modern stack, and you'll build the shared services underneath them that let every other engineering team do the same: financial ledger and payments, authentication and access control, workflow and approvals, job orchestration, feature delivery, data modeling, and internationalization. The value of a Core Service is measured by adoption, so you'll own each one the whole way: API design, client SDK, deployment, observability, documentation, and the hands-on partnership that gets other teams onto it successfully.

We're also rethinking how software gets built here, and we want this role leading that. You'll work with agentic development tooling as a primary part of your workflow and help establish the specifications, harnesses, test strategies and review practices that let AI-assisted engineering land at production quality and scale across the organization.

Because Core Services owns the layer everything depends on, the mandate is deliberately broad. Data model design and long-term evolution, CI/CD automation, and build and test infrastructure are part of the charter rather than side projects, and you'll partner closely with our QA, Platform and Security teams on all three.

This is a hands-on individual contributor role reporting into the architecture organization.

What you'll do

Build greenfield internal services from zero to production and then to broad adoption across multiple engineering teams

Design and build new customer-facing applications in React, Next.js and TypeScript, backed by services you also own

Build administration backends, configurable workflow tooling and other developer-facing surfaces so application teams can lean on shared primitives instead of rebuilding them

Own durable API contracts: versioning, backward compatibility, published SDKs, and migrations that ship without downtime

Organize and curate reusable components to lead other engineers to the right patterns.

Design and evolve data models across PostgreSQL, MySQL and MongoDB as the domain and the business change

Operate what you build: SLOs, instrumentation, alerting and incident follow-through in Datadog

Advance our agentic development practice and the delivery automation, coverage and testing infrastructure that supports it

Write the RFCs, design docs and integration guides that other teams build against, and mentor the engineers who consume your services

Requirements

Education

Bachelor's degree in Computer Science, Software Engineering, Information Technology, or a related technical field (or equivalent combination of education and hands-on practical experience).

Overall Experience

8+ years of professional software engineering experience across the full SDLC, with significant depth in backend and platform work

Demonstrated experience owning production enterprise systems over multi-year horizons. We're looking for engineers who have versioned a widely-used interface, run a real deprecation cycle, migrated consumers onto a new platform, and kept a critical system healthy while the business changed around it

Track record of taking a service from initial design to production and then to adoption by other teams

Comfort building consensus across teams without formal authority: negotiating migration timelines, running design reviews, and making a technical case in writing

Proven experience mentoring junior engineers, understanding stakeholders, and adapting the communication according to the right audience.

Fluency with agentic and AI-assisted development in real production workflows, with full ownership of and accountability for the resulting code

Technical Experience

TypeScript end to end, used as a design tool: discriminated unions, generics with meaningful constraints, branded types for identifiers and monetary values, and runtime validation at trust boundaries with types inferred from schema

Modern JavaScript adopted in practice Node streams with pipeline() and async iteration, native fetch with AbortSignal, AsyncLocalStorage for request context, await using for resource lifecycles, iterator helpers and native grouping and set operations, error cause chains, function composition and currying, ESM with top-level await

Node.js and NestJS at depth: dependency injection, module boundaries, guards, interceptors and lifecycle hooks. Deep Express or Fastify experience with strong DI fundamentals is an acceptable substitute

React and Next.js: hooks, App Router, server components, SSR/CSR tradeoffs and typed clients

Authentication integration in practice: NextAuth and Auth0 federation, session and token handling across multiple applications, organizations and identity providers

API design as a durable contract: REST and/or GraphQL, idempotency, pagination, contract testing, semantic versioning discipline

Polyglot persistence with real modeling judgment: PostgreSQL or MySQL for transactional, money-bearing data (indexing, isolation levels, constraints, safe migrations) and MongoDB for flexible and versioned documents, plus the experience to argue which data belongs where

Asynchronous and event-driven systems: RabbitMQ, SQS or Kafka; idempotent consumers, delivery guarantees, dead-letter handling

Testing as leverage: Jest, Supertest, Playwright or Cypress, Testcontainers; designing seams that make systems testable

Cloud-native delivery: AWS, Docker, Kubernetes, Terraform, GitHub Actions and CD tooling; able to instrument a service and define its SLOs

AI-ready engineer: Knows how to use AI effectively, its limitations, and how to mitigate the shortcomings to reduce the risk, while understanding the role of a human in the loop.

Preferred Qualifications

Financial systems depth: immutable double-entry ledgers, reconciliation, NACHA / ACH origination and return handling, WORM and append-only retention data models, payment processor integrations, or balance integrity guarantees

Identity and access: OAuth 2.0 / OIDC, SAML, multi-tenant RBAC, MFA and token lifecycle including experience implementing an OIDC provider rather than only consuming one

Compliance-constrained engineering: SOC 2, NIST 800-53, FedRAMP/GovRAMP, PCI-DSS or FIPS 140-3, including secret and key management and dependency vulnerability management at scale (Snyk or equivalent)

Workflow and rules engines: state machines, approval routing, SLA tracking, auditable status history

Platform and developer experience: internal SDKs, scaffolding and codegen, service catalogs, reusable CI workflows

Feature flagging and progressive delivery; white-labeling and internationalization in multi-tenant SaaS

Public-sector or GovTech experience, where auditability, records retention and data privacy are first-class requirements

Open-source contribution to the Node, TypeScript or Nest ecosystems

Key Performance Goals

Adoption

Success is measured by whether other teams run on what you build: applications migrated onto each service, time-to-first-successful-integration for a new consumer, and how much of that onboarding is self-service. Shipping is the midpoint of the project, not the end.

Reliability of Shared Infrastructure

Own the operational quality of your services: defined SLOs, meaningful instrumentation and alerting, graceful degradation, and incidents that get root-caused and don't recur.

Interface Stewardship Over Time

Keep contracts stable and evolvable: versioning consumers can plan around, deprecations completed on schedule, migrations executed without downtime, and documentation that stays true as the service changes.

Delivery Velocity

Deliver measurable improvements to how quickly and safely the whole organization ships: build and test duration, suite reliability, release automation, and the maturity of our agentic development practice.

Technical Influence & Mentorship

Raise the engineering bar beyond your own code through design reviews, reference implementations other teams adopt, and mentorship.

Benefits

ClassWallet is a positive, family-oriented team environment. Our focus is on encouragement, positive reinforcement, and gratitude. We work hard and are highly motivated to win but with a healthy perspective on life.

We offer an excellent salary and benefits commensurate with experience.

Questions about this role

Click "Apply with AI Applyd" above and you are done. Your resume is rewritten for this advert, the screening questions are answered, and it is submitted on ClassWallet's own hiring system. No retyping your history, no fourteen tabs, no evening lost.

Compensation for Full-Stack Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Full-Stack Engineer hub for United States medians across recent openings.

You never touch the form - the application is filled and submitted for you on ClassWallet's own hiring system. It is not marked sent when we press submit. It is marked sent when a confirmation from their system arrives at the address we apply with, and your dashboard shows which stage each application is at until then.

Twelve applicant tracking systems have a real apply path: Workday, Greenhouse, Lever, Ashby, Workable, iCIMS, Personio, Recruitee, Teamtailor, Rippling, Breezy and SmartRecruiters. Your application goes in on the employer's own hiring system, never into an aggregator queue.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.