CL

Full Stack Engineer

ClassWallet

USremote countryPosted Jul 30, 2026
Posting intelligenceActively listed

Skills

programmaticpostgreskubernetesjavascripttypescriptplaywrightmongoexpressfastifycypressnextnodedockermysqlreactcsscicdjestaws

About the role

ClassWallet, a leading financial technology company in the United States serving agencies delegated responsibility to manage public funds, is seeking to hire a Full Stack Engineer to join our team.

Agencies use ClassWallet to get public funds to the right people, and ensure the funds are used for the right purpose. ClassWallet's suite of products and services empowers agency administrators to dramatically increase efficiency of funds distribution and spend compliance, reduce programmatic costs, maximize the full potential impact of the program, and satisfy the needs and expectations of policymakers, constituents and public reporting. ClassWallet has processed over $6.7 Billion to date and serves public agencies across 39 states. In its 11+ years in operation, ClassWallet has completed over 12M transactions, funded 1.1M recipients, processed over 5M applications, and now serves 300+ state and local agency clients, supported by a team of 280+ full-time staff.

The Company has developed an industry-defining digital wallet solution which has gained rapid traction among state and local agencies and school districts across America. ClassWallet ranks as the 61st fastest growing software company on the prestigious Inc. 5000 list of fastest-growing private companies and the 21st fastest growing financial technology company on the Deloitte Technology Fast 500 in 2023.

While the Company delivers immense business value, the social impact of ClassWallet is a fabric that runs through its mission and corporate culture. As a result of ClassWallet’s innovation, public programs run with exponentially more efficiency and the impact and breadth of the programs for the individuals they serve is dramatically higher. This mission compliments the Company mission-based culture with focus on gratitude and work-life balance.

About the Role

As a Software Engineer, you will be a hands-on contributor on an engineering team led by our Technical Lead. You’ll own meaningful features end-to-end, from data model and API design through user interface implementation and production readiness. With guidance and mentorship from senior engineers, you’ll continuously your technical scope, ownership, and impact.

This is an individual contributor role where you’ll spend most of your time designing, building, testing, reviewing, and improving software for a modern product platform. While your primary focus will be on a new product development, you’ll also contribute to the maintenance and enhancement of existing applications as needed.

You’ll actively participate in code reviews, technical design discussions, and collaborative problem solving, while developing a deep understanding of our technology stack and business domain. You’ll help uphold a high engineering bar by writing clean, maintainable, well-tested code and continuously improving the quality, reliability, and scalability of our software. You’ll use AI tooling (Claude Code, Copilot) as a force multiplier, not a crutch, while understanding and standing behind every line that lands.

Requirements

Education

Bachelor’s degree in Computer Science, Software Engineering, Information Technology, or a related technical field (or equivalent combination of education and hands-on practical experience).

Overall Experience

4+ years of professional software engineering experience across the full software development life cycle (SDLC).

Growing autonomy: able to scope and break down well-defined work, drive features to completion, and know when to ask for help or escalate rather than getting stuck.

Comfortable participating in code reviews and technical discussions, giving and receiving feedback constructively, and supporting less-experienced engineers as you grow (no formal management experience required).

Domain Experience

2+ years of direct experience building, scaling, or maintaining form-driven or workflow-driven products; for example, dynamic form builders, application/intake platforms, low-code/no-code configuration tools, case-management systems, or high-volume transactional SaaS applications.

Working understanding of domain-specific challenges, such as dynamic form schema design and rendering, conditional/branching logic and field-level validation, multi-step submission state (drafts, autosave, resume), versioning of form definitions, and secure handling of applicant PII.

Experience building accessible web applications that meet Section 508 and WCAG 2.1 AA standards, with particular attention to complex, form-heavy interfaces (keyboard navigation, focus management, ARIA, and screen-reader-friendly error handling).

Technical Experience

4+ years of full-stack development experience heavily focused on the JavaScript/TypeScript ecosystem, with TypeScript used end to end (front and back).

Strong hands-on experience designing and building scalable backend services and RESTful/GraphQL APIs using Node.js and NestJS (DI, guards, interceptors), or deep Express/Fastify experience with a solid grasp of dependency injection.

Solid experience developing responsive, high-performance frontends using React and Next.js (hooks, App Router, server components, SSR/CSR, typed clients).

Practical experience with database design and management across relational and NoSQL stores: PostgreSQL or MySQL for structured, money-bearing/transactional application and submission data (schema, indexing, transactions, constraints, safe migrations), and MongoDB for flexible, versioned form definitions and dynamic profiles.

Testing discipline as a default (unit, integration, and E2E), using tools such as Jest, Playwright/Cypress, and Supertest, treating the test suite as what lets the team move fast safely.

Deliberate, efficient use of AI tooling (Claude Code, Copilot) in real development workflows, with full ownership of the resulting code.

Preferred Qualifications

Form-Builder & Low-Code Depth: Prior experience building configurable/JSON-schema-driven form engines or drag-and-drop form designers (e.g., react-hook-form, Formik, JSON Schema / react-jsonschema-form), including rendering, validation, and versioning of dynamic form definitions.

Workflow & Case-Management Experience: Familiarity with workflow/BPM or state-machine engines and approval routing, including SLA tracking, delegation, and auditable status histories.

Accessibility Expertise: Demonstrated experience running accessibility audits and remediation against Section 508 / WCAG 2.1 AA, including assistive-technology and screen-reader testing.

Security & Compliance Awareness: Familiarity with industry-standard compliance frameworks and security protocols, such as SOC 2, NIST, or PCI-DSS, and experience applying these controls within a cloud-native software development lifecycle.

Public-Sector / GovTech Experience: Experience delivering software for government agencies, education, or other public programs, where auditability, records retention, and data privacy are first-class requirements.

Cloud & Delivery: Hands-on experience with AWS, Docker, Kubernetes, and CI/CD pipelines.

Key Performance Goals

High-Quality Feature Delivery

Consistently deliver well-tested, high-quality product features on time. Scope your assigned work accurately within agile sprints and proactively flag technical roadblocks so they can be resolved.

Platform Quality & Stability

Contribute directly to the scalability, security, reliability, and accessibility of the applications platform (across NestJS, Next.js, PostgreSQL/MySQL, and MongoDB) by writing maintainable code, following code review standards, meeting Section 508 / WCAG 2.1 AA requirements, and minimizing production bugs.

Collaboration & Growth

Actively participate in code reviews and design discussions, absorb and apply feedback, and steadily grow your technical range and the scope of work you can own in partnership with senior engineers and the Technical Lead.

Core Technical Contribution

Take ownership of meaningful features and components including parts of the form engine, submission pipeline, and workflow/approval model and contribute to system design discussions. Grow toward larger architectural responsibility while collaborating closely with the team and the Technical Lead.

Benefits

ClassWallet is a positive, family-oriented team environment. Our focus is on encouragement, positive reinforcement, and gratitude. We work hard and are highly motivated to win but with a healthy perspective on life.

We offer an excellent salary and benefits commensurate with experience.

Questions about this role

Click "Apply with AI Applyd" above and you are done. Your resume is rewritten for this advert, the screening questions are answered, and it is submitted on ClassWallet's own hiring system. No retyping your history, no fourteen tabs, no evening lost.

Compensation for Full-Stack Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Full-Stack Engineer hub for United States medians across recent openings.

You never touch the form - the application is filled and submitted for you on ClassWallet's own hiring system. It is not marked sent when we press submit. It is marked sent when a confirmation from their system arrives at the address we apply with, and your dashboard shows which stage each application is at until then.

Twelve applicant tracking systems have a real apply path: Workday, Greenhouse, Lever, Ashby, Workable, iCIMS, Personio, Recruitee, Teamtailor, Rippling, Breezy and SmartRecruiters. Your application goes in on the employer's own hiring system, never into an aggregator queue.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.