Visa logo

Sr. Product Manager

Visa

Los Angeles, USonsite$159k-$244k/yrPosted Mar 23, 2026

At a glance

Highlights

  • multiple openings
  • hybrid role with office presence
  • lead and mentor junior product managers

Heads up

  • domestic travel required
  • office presence 2-3 days per week

Why this role might suit you

The role allows leading a product team at a global payments leader, shaping authentication solutions, working with advanced data infrastructure, and enjoying a hybrid schedule that balances office collaboration with remote flexibility.

Skills

rtableaupythonauthentication-data-sourcesemv-3dsvisa-secureauthorization-datavcasvrmsproduct-developmentfinancial-servicespaymentsbusiness-intelligencedata-infrastructure

About the role

Visa is a world leader in payments and technology, with over 259 billion payments transactions flowing safely between consumers, merchants, financial institutions, and government entities in more than 200 countries and territories each year. Our mission is to connect the world through the most innovative, convenient, reliable, and secure payments network, enabling individuals, businesses, and economies to thrive while driven by a common purpose – to uplift everyone, everywhere by being the best way to pay and be paid.Make an impact with a purpose-driven industry leader. Join us today and experience Life at Visa.

Visa U.S.A. Inc., a Visa Inc. company, needs a Sr. Product Manager (multiple openings) in Los Angeles, California to:Analyze business performance using data and develop monitoring tools to support strategic decision-making.Upgrade and maintain data infrastructure and Business Intelligence systems to enhance operational efficiency.Leverage data insights to define product positioning, inform product strategy, and support market and internal optimization efforts.Assess ecosystem health and contribute to the continuous improvement of Visa’s product offerings.Serve as a subject matter expert in Visa Authentication solutions, providing guidance and leadership in this domain.Lead and mentor a team of junior product managers, managing priorities and fostering professional development.Domestic travel required 5 – 10% of the time.The position reports to the Los Angeles, CA office and may allow for partial telecommuting.

Basic Qualifications: Employer will accept a Bachelor's degree in Actuarial Science, Mathematics, Computer Science, or related field and 8 years of experience in the job offered or in a data analysis, product management, or risk management-related occupation. Position requires experience in the following: Data analysis tools like R, Tableau, and Python;Deep understanding in authentication data sources and Visa Secure / EMV 3DS fields and messages;Deep understanding of authorization data;Visa Risk tools, specifically VCAS, VRM;Product development/deployment; andFinancial Services/Payments.

Worksite: Los Angeles, CaliforniaThis is a hybrid position. Hybrid employees can alternate time between both remote and office. Employees in hybrid roles are expected to work from the office 2-3 set days a week (determined by leadership/site), with a general guidepost of being in the office 50% or more of the time based on business needs.Travel Requirements: Domestic travel required 5 – 10% of the time.Mental/Physical Requirements: This position will be performed in an office setting.  The position will require the incumbent to sit and stand at a desk, communicate in person and by telephone, frequently operate standard office equipment, such as telephones and computers.Visa is an EEO Employer.  Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, sexual orientation, gender identity, disability or protected veteran status.  Visa will also consider for employment qualified applicants with criminal histories in a manner consistent with EEOC guidelines and applicable local law.Visa will consider for employment qualified applicants with criminal histories in a manner consistent with applicable local law, including the requirements of Article 49 of the San Francisco Police Code.U.S. APPLICANTS ONLY: The estimated salary range for this position is $158,808.00 to $243,700.00 USD per year, which may include potential sales incentive payments (if applicable). Salary may vary depending on job-related factors which may include knowledge, skills, experience, and location. In addition, this position may be eligible for bonus and equity. Visa has a comprehensive benefits package for which this position may be eligible that includes Medical, Dental, Vision, 401 (k), FSA/HSA, Life Insurance, Paid Time Off, and Wellness Program.

Compensation

This Product Manager role pays $159k-$244k/yr. Within typical range for product manager roles in United States.

Questions about this role

  • How do I apply to this Sr. Product Manager role at Visa?

    Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

  • What's the typical salary for Product Manager in United States?

    Compensation for Product Manager roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Product Manager hub for United States medians across recent openings.

  • How fast does AI Applyd auto-apply?

    Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

  • What ATS does Visa use?

    AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, LinkedIn Easy Apply, and most other ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.