Skip to content

Founding Product Growth Lead

Harvey AI

San Francisco, USremote country$237k-$321k/yrPosted Mar 5, 2026

At a glance

Highlights

  • Opportunity to shape product-led growth strategy for a generational AI company
  • Competitive compensation with equity upside
  • Work with world-class investors and a fast-growing team
  • High-impact role in transforming legal services

Why this role might suit you

The role provides a unique chance to define growth strategy for an AI platform reshaping legal services, offering competitive pay, equity, and the chance to lead high-impact initiatives alongside a world-class team in a fast-growing startup.

Skills

sqlamplitudemixpanelab-testinggrowth-analyticspricingpackagingself-servegrowth-strategyproduct-analyticsexperimentationb2b-saasenterprise-adoptionai

About the role

Why HarveyAt Harvey, we’re transforming how legal and professional services operate — not incrementally, but end-to-end. By combining frontier agentic AI, an enterprise-grade platform, and deep domain expertise, we’re reshaping how critical knowledge work gets done for decades to come.

This is a rare chance to help build a generational company at a true inflection point. With 1000+ customers in 60+ countries, strong product-market fit, and world-class investor support, we’re scaling fast and defining a new category in real time. The work is ambitious, the bar is high, and the opportunity for growth — personal, professional, and financial — is unmatched.

Our team is sharp, motivated, and deeply committed to the mission. We move fast, operate with intensity, and take real ownership of the problems we tackle — from early thinking to long-term outcomes. We stay close to our customers — from leadership to engineers — and work together to solve real problems with urgency and care. If you thrive in ambiguity, push for excellence, and want to help shape the future of work alongside others who raise the bar, we invite you to build with us.

At Harvey, the future of professional services is being written today — and we’re just getting started.

Role OverviewHarvey is looking for a Growth Product Lead to own and drive the product-led growth strategy for our AI platform. This is a foundational role - the first dedicated growth product hire at Harvey - and an opportunity to define how we acquire, activate, and expand users across the world's leading law firms, in-house legal teams, and professional services organizations. You will sit at the intersection of Product, Marketing, and GTM, combining deep product thinking with a data-driven experimentation mindset to unlock new levers for growth. Reporting to the VP of Product, you will work cross-functionally with Engineering, Design, Marketing, Sales, and Customer Success to build the systems, features, and experiences that accelerate Harvey's trajectory.

What You'll Do- Define and own Harvey's product-led growth strategy, identifying the highest-impact opportunities across the user lifecycle — from acquisition and activation to engagement, retention, and expansion.

- Build and run a rigorous experimentation program: develop hypotheses, design A/B tests, and iterate quickly based on data to optimize key growth metrics (e.g., activation rate, time-to-value, feature adoption, expansion revenue).

- Partner closely with Engineering and Design to ship growth-oriented product features — including onboarding flows, in-product nudges, self-serve capabilities, and viral loops — at the pace Harvey operates.

- Collaborate with Marketing (Demand Gen, Lifecycle, Performance Marketing) to connect top-of-funnel acquisition efforts to in-product activation and conversion.

- Work with Sales and Customer Success to understand enterprise adoption patterns, identify product-driven expansion opportunities, and reduce friction in the customer journey.

- Define, instrument, and monitor growth KPIs; build dashboards and reporting to give the business clear visibility into growth performance.

- Inform pricing, packaging, and self-serve strategy in partnership with GTM leadership.

- Champion a culture of experimentation and data-informed decision-making across teams.

What You Have- 8+ years of product management experience, with at least 3 years focused on growth, product-led growth (PLG), or growth engineering at a high-growth B2B SaaS company.

- Proven track record of driving measurable growth outcomes — you have shipped experiments and features that moved key business metrics (activation, retention, expansion, revenue).

- Deep fluency in growth analytics: you are comfortable with SQL, product analytics tools (Amplitude, Mixpanel, or similar), and building data narratives that drive decisions.

- Strong product sense — you can identify high-leverage opportunities, scope MVPs, and ship quickly without sacrificing quality.

- Excellent cross-functional collaboration skills, with experience partnering across Engineering, Design, Marketing, Sales, and Customer Success.

- Startup or high-growth experience — you thrive in ambiguity, move fast, and are comfortable building from zero.

- Passion for AI and its potential to transform professional services.

Nice to Have

- Experience with enterprise or sales-assisted PLG motions (not purely self-serve consumer growth).

- Familiarity with legal technology, professional services, or vertical SaaS.

- Experience building self-serve onboarding or trial experiences in B2B.

Compensation

$236,500 - $320,500 USD

Depending on your location, an Applicant Privacy Notice may apply to you. You can find all of our Applicant Privacy Notices [here].

#LI-ML1

Harvey is an equal opportunity employer and does not discriminate on the basis of race, gender, sexual orientation, gender identity/expression, national origin, disability, age, genetic information, veteran status, marital status, pregnancy or related condition, or any other basis protected by law.

We are committed to providing reasonable accommodations to applicants with disabilities, and requests can be made by emailing accommodations@harvey.ai

Compensation

This Marketing role pays $237k-$321k/yr. Within typical range for marketing roles in United States.

Questions about this role

  • How do I apply to this Founding Product Growth Lead role at Harvey AI?

    Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

  • What's the typical salary for Marketing in United States?

    Compensation for Marketing roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Marketing hub for United States medians across recent openings.

  • How fast does AI Applyd auto-apply?

    Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

  • What ATS does Harvey AI use?

    AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, LinkedIn Easy Apply, and most other ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.