Staff Software Engineer - User Interface

GE Vernova

Hyderabad, INonsitePosted Aug 6, 2026
Posting intelligenceActively listed

Skills

azure devopspostgresjavascripttypescriptsqlalchemyreactjenkinstrelloplotlygithubpythonhtmlazurefigmajiracicdjavacssc#

About the role

Consulting Services, a part of GE Vernova, has offices in multiple countries and offers our global clients (external & internal GE) a wide range of solutions across the entire spectrum of power generation, delivery, and utilization. Our Power Systems Engineering team utilizes their deep knowledge of connected power grid planning, design, operation, and life-cycle management, to offer customized solutions to our global clients. Our Power Economics team offers analyses focused on the understanding and the study of the financial and physical operation of the electric power systems including generation and grid planning, system optimization, asset valuation, competitive power markets and energy policy implications. Our software business plays a critical role in delivering these solutions by developing and maintaining cutting-edge analytics platforms for production cost modeling, capacity expansion, reliability assessment, market simulation and both steady-state and transient stability simulation. These tools are continuously enhanced based on feedback from consulting engagements and evolving industry needs.

The Staff Software Engineer (User Interface) will play a key role in designing, developing, and maintaining reusable UI components and services that power the PlanOS platform. PlanOS is GE Vernova’s next-generation energy planning platform, designed to support utilities and system operators in making data-driven, future-ready decisions for grid reliability, resource adequacy, and decarbonization strategies. This role involves working primarily on web-based UI design systems using the React Javascript Framework and backend services using Python. The developer will be responsible, in conjunction with the PlanOS UI/UX Design and Devlopment team, for the full software development lifecycle - including requirement analysis, documentation, implementation, and ongoing maintenance - with a strong focus on scalability, performance, and usability.

Job Description

Roles & Responsibilities

Partner with key stakeholders to understand functionality needs for PlanOS.

Work closely with UX team members to refine user workflows and visual layouts using industry-standard UX tools such as Figma.

Develop and maintain reusable UI components using ReactJS, TypeScript, HTML5, and CSS.

Collaborate with UX designers and product owners to implement user-friendly designs based on specifications and feedback.

Translate customer and business requirements into clean, testable, and maintainable front-end code.

Optimize applications for performance, accessibility, and responsiveness.

Integrate with REST APIs and collaborate with back-end developers to deliver full-stack solutions.

Participate in an Agile scrum team, providing technical leadership and peer code reviews.

Contribute to the improvement of UI development processes, tools, and standards.

Support documentation, testing, and knowledge sharing across the team.

Required Qualifications

Bachelor’s or Master's Degree in Software Engineering, Computer Science, or related field from an accredited college or university

8 to 11 years software development experience, with at least three years front-end development experience.

Demonstrated proficiency in ReactJS, TypeScript, HTML5, and CSS.

Strong understanding of RESTful APIs and integrating front-end with backend services.

Solid grasp of UX design principles and familiarity with modern UX tools such as Figma.

Solid grasp of the Software Development Lifcycle, agile project management, and project management tools like Jira, Trello, or Azure DevOps.

Desired Characteristics

Strong communication and problem-solving skills

Experience building responsive applications compatible with modern browsers.

Familiar with GitHub, NPM, and CI/CD tools (e.g., Jenkins).

Excellent problem-solving, communication, and collaboration skills.

Knowledge of Mapbox, PostgreSQL, and Trello

Exposure with Python and libraries like Altair and Plotly for data visualization, SQLAlchemy, and Pyramid.

Self-starter with the ability to lead development projects

Proficient with Microsoft Office Suite

Demonstrated application of complex mathematics and engineering to real-world electric power system problems

Thorough understanding of the software development life cycle and modern software development methodologies (i.e., agile)

Demonstrated knowledge of software development in modern object-oriented languages (C#, Java, Python, etc.)

Comfortable collaborating in an Agile sprint planning environment

Experienced in leading A/B testing efforts and applying analytical thinking to UX design

Experience in the Power & Energy domain

Demonstrates the initiative to explore alternate technology and approaches to solving problems

Skilled in breaking down problems, documenting problem statements and estimating efforts

Demonstrates awareness about competitors and industry trends.

Has the ability to analyze impact of technology choices.

Additional Information

Relocation Assistance Provided: Yes

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Software Engineer roles in India varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer hub for India medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.