Senior Backend Engineer

Indio Networks Pvt Ltd

Pune, INonsitePosted Jul 24, 2026
Posting intelligenceActively listed

Skills

prometheustypescripttimeserieslaravelgrafananodedockerpythonmysqlcicdphpjavascriptgo

About the role

Senior Backend Developer

Location: Pune Department: Engineering / Platform Development Experience: 5–8 Years Employment Type: Full-Time

About the Role

We're looking for a Senior Backend Developer who enjoys building robust backend systems and isn't afraid to work beyond the application layer. This role is ideal for someone who understands that building reliable software also means understanding the Linux environment it runs on and the networking fundamentals that keep it connected.

Our current platform is built on Linux, Apache/Nginx, MySQL, and PHP (Laravel & CodeIgniter). As we continue to modernize our technology stack, we're investing in Go, Node.js (TypeScript), and Python. We're not looking for someone who knows every technology we use today - we're looking for someone with strong engineering fundamentals who can quickly learn and adapt to new tools and technologies.

What You'll Do

Design, develop, and maintain scalable backend applications and services.

Build and maintain REST APIs and platform components.

Develop and optimize backend systems running on Linux.

Write Shell/Bash scripts to automate deployments, maintenance, and operational tasks.

Design and optimize MySQL databases while evaluating NoSQL or time-series databases where appropriate.

Troubleshoot issues across application, database, Linux, and networking layers.

Collaborate with Infrastructure and DevOps teams on deployments, performance tuning, and platform reliability.

Participate in code reviews, architecture discussions, and technical decision-making.

Evaluate and recommend technologies that improve the platform's scalability, performance, and maintainability.

What We're Looking ForBackend Development

5–8 years of software development experience.

At least 2–3 years of hands-on backend development.

Strong programming fundamentals and software design principles.

Experience with PHP is a plus.

Exposure to Go, Node.js/TypeScript, or Python is highly desirable.

Experience designing and developing RESTful APIs.

Linux & Networking Fundamentals

We're not looking for a Linux Administrator or Network Engineer, but you should be comfortable working in Linux environments and understand the networking concepts that support modern backend applications.

You should be familiar with:

Linux distributions such as Debian, Ubuntu, or CentOS/RHEL

Shell/Bash scripting

System services, logs, processes, permissions, and package management

TCP/IP fundamentals and basic network troubleshooting

DNS, DHCP, VPN, and RADIUS concepts

Using common diagnostic tools such as ping, curl, dig, ss/netstat, traceroute, and tcpdump

The ability to troubleshoot issues across application code, operating systems, and networking is more important than deep infrastructure specialization.

Databases

Strong experience with MySQL.

Knowledge of database design and query optimization.

Exposure to NoSQL or time-series databases is an advantage.

Nice to Have

Docker and containerization

CI/CD pipelines

Grafana, Prometheus, or InfluxDB

Cloud infrastructure experience

Hosting, ISP, or telecom domain experience

Monitoring and observability tools

Performance tuning and system optimization

What Makes You Successful

We're looking for engineers who:

Have strong technical fundamentals.

Take ownership and solve problems end-to-end.

Learn new technologies quickly.

Enjoy understanding how systems work beyond just writing code.

Can contribute to architecture discussions and technical decisions.

Write clean, maintainable, and scalable software.

Qualifications

Bachelor's degree in Computer Science, Information Technology, or a related field (or equivalent practical experience).

5–8 years of professional software development experience.

Minimum 2–3 years of hands-on backend development.

Why Join IndioCloud?

Build a platform that combines backend engineering, Linux, and networking.

Work with modern technologies while helping evolve our platform.

Contribute to architectural and technology decisions.

Solve challenging real-world engineering problems.

Join a collaborative team where your ideas and technical expertise have a direct impact.

Pay: ₹600,000.00 - ₹800,000.00 per year

Benefits:

Health insurance

Paid sick time

Paid time off

Provident Fund

Application Question(s):

How many years of experience you have?

Currently are you located in which city?

How many years of experience backend?

What is your current CTC?

What is your expected CTC?

What is your notice period?

Are you comfortablre to relocate to pune?

Work Location: In person

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Backend Engineer roles in India varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Backend Engineer hub for India medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.