Java Full Stack Engineer

Cognizant

Guadalajara, MXhybridPosted Jul 21, 2026
Posting intelligenceActively listedReposted 28×, possible evergreen/ghost posting

Skills

postgreskubernetestypescripthibernateangularspringdockeroraclehtmlkafkaredismysqlcsscicdjava

About the role

We are seeking a highly experienced Lead/Senior Java Backend & Full-Stack Engineer with 8 to 10+ years of hands-on experience to drive the architecture, development, and delivery of enterprise software solutions. In this role, you will lead backend engineering efforts using Core Java and Spring Frameworks while actively driving UI application architecture, design structures, and frontend development workflows. This role demands domain expertise in retail order management and a strong background in building resilient, distributed server applications in Unix environments.

Job Summary

Seeking a visionary Full Stack Engineer (FSE) Architect to lead application modernization initiatives. You will define architectural blueprints design high-performance systems and lead cross-functional teams bridging the gap between scalable backend microservices and modern frontend UIs. This role requires a hands-on leader to enforce best practices mentor senior developers and collaborate with stakeholders to deliver resilient business solutions

Responsibilities

Key Responsibilities

1. Enterprise Architecture & System Design

Design and implement end-to-end cloud-native application architectures using Java and Angular frameworks.

Architect distributed resilient and fault-tolerant backend ecosystems utilizing Microservices-Based Architecture and Spring Boot frameworks.

Drive the adoption of Reactive Programming paradigms using Spring WebFlux and Project Reactor to build non-blocking event-driven high-throughput applications.

Design highly parallelized low-latency execution engines using advanced Java Multithreading Concurrency utilities and asynchronous processing models.

Establish standard design patterns microservices deployment practices and structural component libraries across front-end and back-end tiers.

2. Front-End Engineering Leadership

Architect scalable maintainable and highly secure single-page applications (SPA) using modern Angular versions.

Define state management strategies (such as NgRx or Akita) modular design lazy loading structures and performance optimization techniques for corporate web platforms.

Ensure application accessibility internationalization and optimized rendering behaviors across varying client environments.

3. Database Engineering & Performance Optimization

Design relational database schemas optimize structured queries (SQL) and construct advanced indexing strategies.

Implement efficient data persistence mechanisms using Spring Data Hibernate and transaction management protocols.

Conduct extensive performance tuning memory profiling and bottleneck analysis across application servers and database instances.

4. Technical Team Leadership & Governance

Lead mentor and inspire a global team of Full Stack Engineers establishing an agile engineering culture focused on clean code automated unit testing and continuous optimization.

Conduct comprehensive code reviews manage technical debt and ensure adherence to international security standards (such as OWASP Top 10).

Define continuous integration and automated deployment pipelines (CI/CD) to streamline production software releases.

Required Technical Skills & Qualifications

Experience: 12+ years of professional software development experience with at least 3+ years operating in an explicit Technical Architect or Principal Engineer capacity.

Backend Core Stack: Deep expertise in Core Java Spring Boot Spring Cloud Spring WebFlux Reactive Streams and robust Java Multithreading.

Frontend Core Stack: Expert-level mastery of Angular TypeScript RxJS HTML5 CSS3/SASS and responsive component UI construction.

Database & Messaging: Strong proficiency in SQL (PostgreSQL Oracle or MySQL) caching systems (Redis) and event brokers (Kafka or RabbitMQ).

Architecture Paradigms: In-depth knowledge of RESTful API design Domain-Driven Design (DDD) Event-Driven Architecture CI/CD automation Docker and Kubernetes orchestration.

Soft Skills: Exceptional communication stakeholder management and team-building capability.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Full-Stack Engineer roles in Mexico varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Full-Stack Engineer hub for Mexico medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.