Full Stack Software Engineer

DomainTools

Austin, USremote country$125k-$165k/yrPosted Jul 21, 2026
Posting intelligenceActively listedReposted 4×, possible evergreen/ghost posting

Skills

mlkubernetesjavascripttypescriptplaywrighttestcafelaraveldockerhtmlmysqlreactcssjestphpgo

About the role

DomainTools is seeking a Software Engineer to join our Frontend Team. This position is perfect for someone interested in building powerful cybersecurity products and features for our enterprise customers. Our solutions help fuel mission critical efforts for customers including gathering threat intelligence, doing threat hunting, and performing online fraud investigation, and more.

At DomainTools, you will work as part of a collaborative team of smart and engaged engineers. Expect to spend most of your time developing modern JavaScript single page applications powered by PHP middleware APIs. You will work in an environment where productivity is fostered. You will spend very little time in meetings, and you won’t be distracted by processes that get in the way of high-quality results.

Have you worked with modern PHP OOP frameworks such as Laravel of Symfony? Are you well versed in using CSS and UX to make beautiful and streamlined designs? Have you built successful end to end testing solutions? If you answered yes to any of these questions we would like to chat with you. However, it is required that you are very comfortable with JavaScript.

Job Responsibilities:

Produce well designed, testable, efficient code using software development best practices.

Integrate with and utilize data from backend services and databases.

Build web applications using PHP on the backend and JavaScript (ES7+), HTML5, and CSS3 on the frontend.

Contribute to new product ideation and implementation as well as to feature development of existing products.

Collaborate with teammates by actively participating in code reviews, contributing to technical documentation, and offering constructive design feedback.

Become a subject matter expert on DomainTools’ customer facing products and services.

Requirements

Work experience: 3+ years of modern web application development.

Experience with modern PHP frameworks (Laravel, Symfony).

Solid knowledge of the following:

Object oriented PHP 7+ programming

JavaScript (ES7+)

TypeScript

HTML5 and CSS3

Deep understanding of React 18+ and Redux.

Experience with unit and integration testing (PHPUnit, Jest).

Demonstrable experience building and consuming APIs.

Proficiency with version control systems, particularly Git.

Experience with container technologies, particularly Docker.

Pluses:

Familiarity with configuring Babel, Webpack, and ESLint.

Experience with orchestration platforms, particularly Kubernetes.

Experience with user acceptance/E2E testing (TestCafe, Playwright).

Familiarity interacting with relational databases (MySQL).

Experience with UX design and related concepts.

Experience using agile principles and methodologies.

Bachelor’s degree or higher in Computer Science or a related field.

Benefits

DomainTools is the global leader for Internet intelligence and the first place security practitioners go when they need to know. The world’s most advanced security teams use our solutions to identify external risks, investigate threats, and proactively protect their organizations in a constantly evolving threat landscape. DomainTools constantly monitors the Internet and brings together the most comprehensive and trusted domain website and DNS data to provide immediate context and machine-learning driven risk analytics delivered in near real-time.

DomainTools offers a comprehensive benefits package to our employees that includes fully paid medical, dental and vision insurance premiums, a 401k retirement plan with company matching, basic life insurance, flexible PTO and additional well-being benefits.

Compensation

This Full-Stack Engineer role pays $125k-$165k/yr. Within typical range for full-stack engineer roles in United States.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Full-Stack Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Full-Stack Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.