Senior QA Engineer - Sports

LeoVegas

Málaga, EShybridPosted Jul 17, 2026
Posting intelligenceActively listedReposted 42×, possible evergreen/ghost posting

Skills

javascripttypescriptplaywrightgrafanadatadogcicd

About the role

ABOUT THE ROLE:

At the core of LeoVegas Group is Team Leo. Our culture is our foundation and is what enables us to innovate, build, and lead as we trailblaze our way through the igaming industry. We’re a team of over 2000 innovators, initiators, and groundbreakers working in a fast-paced and agile environment across 19 offices worldwide. Are you an experienced Automation QA Engineer looking to make an impact in a fast-paced, dynamic environment? Join our Sportsbook Domain and become part of the Sports Betting team at LeoVegas Group, where you’ll help shape and enhance our sports product capabilities. You will take end-to-end ownership of your domain quality, working hands-on with automation and end-to-end validation. Your work will ensure a secure, seamless, and enjoyable experience for customers across all our brands.

In this role, you will contribute directly to strengthening our sportsbook platform by designing effective tests and defining clear testing scopes that align with our business needs. Working in an Agile environment, you will collaborate with highly skilled frontend and backend developers, along with dedicated Quality Assurance Engineers, to deliver high-quality solutions that support a reliable and engaging customer experience.

YOU WILL BE RESPONSIBLE FOR:

Drives high-impact outcomes by leading complex, ambiguous projects and resolving critical issues that directly influence business quality and performance

Shapes testing strategy and architecture by leading test design for complex problems, ensuring reliability, observability and alignment with business priorities

Communicates risks, insights and technical considerations clearly to both technical and non technical stakeholders, contributing meaningfully to roadmaps and planning

Uplifts QA practices across squads by promoting best practices, anticipating issues through strong processes and enabling others to improve testing for performance, scale and security

OUR SUCCESSFUL CANDIDATE WILL HAVE THE FOLLOWING:

ESSENTIAL SKILLS

Experience with frontend testing including UI automation using Typescript (Playwright)

Typescript/Javascript programming experience

Experience with visual testing

Experience with backend testing

Proficiency with test management tools such as TestRail

Understanding of modern software development practices in Agile/Scrum self-organizing teams and DevOps environments

NICE TO HAVES

ISTQB certification

Familiarity with microservice architectures

Experience with accessibility testing

Practical experience improving CI/CD pipelines

Experience with Grafana, Datadog or any other monitoring tool

Interest/experience in Gambling domain

WHO WE ARE

At the core of LeoVegas Group is Team Leo. Our culture is our foundation and is what enables us to innovate, build, and lead as we trailblaze our way through the igaming industry. We’re a team of over 2000 innovators, initiators, and groundbreakers working in a fast-paced and agile environment across 21 offices worldwide.

BENEFITS

Hybrid work policy (2 days a week of working from home)

4 weeks of Workation (T&C apply)

300 EUR wellness contribution annually

Cobee - benefits app with flexible compensation and discounts

Health insurance (we use Alan)

Life insurance

Employee Assistance Program (free emotional, legal, and financial support)

Short Fridays - we work until 16:00

Complimentary snacks and drinks in our offices, Monday breakfast and Wednesday fika (Swedish break for coffee and something sweet)

Team and office social events throughout the year

JOIN US!

In our pride, we empower our teammates to find their roar and run with their wildest ideas. We don’t wait for things to happen; we pounce and make it happen!

Would you be a good fit for the Leo Pride - give us a roar!

As our company working language is English, we’d like to see your CV in English, please

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for QA Engineer roles in Spain varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our QA Engineer hub for Spain medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.