AI ApplydAIAPPLYD

.NET Developer with React & Node.js Experience (Contract)

Symhas

Dallas, USonsitePosted Jul 15, 2026
Posting intelligenceActively listedReposted 2×, possible evergreen/ghost posting

Skills

azure devopspostgressqlalchemyplaywrighttailwindangularnodegithubpythonazuremssqlreactcicdjavascript

About the role

Location: Dallas, TX or Phoenix, AZ (Onsite)

Duration: 6-month contract

Experience: 6-8 years

Work Authorization: Only U.S. Citizens and Green Card holders will be considered. Candidates must be able to work on our W2.

Position Summary

We are seeking a .NET Developer with strong React and Node.js experience, along with FastAPI (Python), to develop high-quality, secure full stack applications in the lending domain. The role involves building secure authentication flows, designing CI/CD pipelines, and rapidly prototyping and iterating alongside architects, product owners, and cross-functional teams in a strong agile environment.

Technical Stack

Frontend: Angular, React + Vite + Tailwind

Backend: .NET, FastAPI (Python), Node.js

Database: PostgreSQL, MSSQL (SSMS)

ORM: SQLAlchemy / EF Core

Testing: Playwright

DevOps: Azure DevOps + Azure App Services, GitHub Actions

Security: Veracode + OWASP + Key Vault; understanding of DAST, SAST, and SCA vulnerabilities

AI Layer: GitHub Copilot + Agent workflows

Tools: Node.js, VS Code, Git, SSMS

Domain: Lending / loan lifecycle, collateral tracking

Responsibilities

Develop high-quality full stack applications using .NET, React, and API frameworks

Build secure authentication flows and integrate enterprise identity providers

Design and implement CI/CD pipelines (GitHub Actions / Azure DevOps)

Work closely with architects, including the team's AI/Tech architect

Participate in agile ceremonies and support a strong agile transformation

Collaborate with cross-functional teams (Dev, QA, DevOps, Security Ops, Governance)

Rapidly prototype, iterate, and deliver results quickly per product owner expectations

Required Experience

6-8 years of full stack development experience, including ASP.NET 4.5

Strong hands-on experience with React and Node.js

Understanding of DAST, SAST, and SCA vulnerabilities and secure development practices

Lending / loan lifecycle or collateral tracking domain experience strongly preferred

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Frontend Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Frontend Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.

Start freeReport this listing