Senior AI Engineer

Luxoft

remote globalPosted Jul 14, 2026
Posting intelligenceActively listed

Skills

confluencematplotlibjavascripttypescriptplaywrightterraformlangchainseleniumtableaufargateairflownextdockerpandaspythonnumpyneo4jreactjiraawsllmml

About the role

Project description

We are looking for an experienced AI Engineer to design and deliver scalable Gen AI solutions. The role involves building production-ready AI products using Python, React, and AWS, while leveraging modern architectures such as LLM pipelines, RAG, and agent-based systems.

This role is for subcontractors.

Responsibilities

AI Engineer Responsibilities

Lead and actively contribute to the development of AI products, pilots and solutions, with a focus on clean, maintainable code using Python, React, and AWS tools.

Design, architect and build scalable Gen AI solutions, including LLM pipelines, Agentic, MCP, Graph/RAG architectures, and prompt-based applications and emerging tech.

Implement cloud-native solutions using AWS services such as EKS, Lambda, Fargate, Glue, and Athena.

Optimize performance of AI products, Drive continuous learning and experimentation with cutting-edge Gen AI methods, frameworks, APIs, and toolchains.

Work closely with product managers, data scientists, and domain experts to define technical solutions aligned with business needs.

Act as a subject matter expert (SME) on Gen AI technologies and help shape the organization's AI roadmap.

Own end-to-end delivery of Gen AI solutions. Manage timelines, deliverables, and project milestones using Agile practices (Scrum/Kanban).

Monitor operational metrics and incident data to drive continuous improvement and reliability.

Ensure adherence to governance, DevSecOps protocols.

Skills

Must have

Experience/Skiils:

6+ years of progressive experience in engineering roles, including at least 1-2 years leading emerging tech or AI initiatives.

Gen AI models (GPT, Claude, Gemini, LLaMA) and prompt engineering techniques

Agentic AI, MCP, and Graph/RAG architectures

Gen AI Framework (LangChain, LlamaIndex, Amazon Bedrock)

Web application development using Next.js, React, TypeScript/JavaScript

AWS cloud services (EC2, ELB/GLB/NLB, EKS, Fargate, Lambda, Athena, Glue, Lake Formation)

Infrastructure as Code (Puppet, Terraform, Docker) and containerized deployments

ETL orchestration using Apache Airflow/DAGs

Vector/Graph databases (Weaviate, Milvus, PGVector, Neo4J, Neptune) and query optimization

Python programming (NumPy, Pandas, Matplotlib, Boto3)

Automated testing frameworks (Ragas, Playwright, Zephyr, Selenium,)

Familiarity with SDLC best practices, DevSecOps, Agile Scrum/Kanban, and work management tools (JIRA, Confluence, JIRA Align).

Knowledge of LLM fine tuning techniques

Experience in BI tools like QuickSight, Tableau

Knowledge of financial markets and enterprise data systems

Nice to have

Other

Languages

English: C1 Advanced

Seniority

Senior

Remote Canada, Canada

Req. VR-123788

AI/ML

BCM Industry

14/07/2026

Req. VR-123788

Questions about this role

Click "Apply with AI Applyd" above and you are done. Your resume is rewritten for this advert, the screening questions are answered, and it is submitted on Luxoft's own hiring system. No retyping your history, no fourteen tabs, no evening lost.

Compensation varies by seniority, employer size, and location. When this listing publishes a salary band you'll see it in the badge row above the description.

You never touch the form - the application is filled and submitted for you on Luxoft's own hiring system. It is not marked sent when we press submit. It is marked sent when a confirmation from their system arrives at the address we apply with, and your dashboard shows which stage each application is at until then.

Twelve applicant tracking systems have a real apply path: Workday, Greenhouse, Lever, Ashby, Workable, iCIMS, Personio, Recruitee, Teamtailor, Rippling, Breezy and SmartRecruiters. Your application goes in on the employer's own hiring system, never into an aggregator queue.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.