AI ApplydAIAPPLYD

React and Node.js FSD Engineer

Tata Consultancy Services (TCS)

Dallas, USonsite$100k-$120k/yrPosted Jul 9, 2026
Posting intelligenceActively listed

Skills

azure devopspostgressqlalchemyplaywrighttailwindangularnodegithubpythonazuremssqlreactjavascript

About the role

React and Node.js FSD Engineer

We need React.Net. FastAPI(Python) and Node.js with the following skill sets:

Frontend: Angular, React + Vite + Tailwind

Backend: FastAPI (Python) , .NET , Node.js

Should have understanding of DAST, SAST, SCA vulnerabilities.

DB: PostgreSQL ,

ORM: SQLAlchemy / EF Core

Testing: Playwright

DevOps: Azure DevOps + Azure App Services

Security: Veracode + OWASP + Key Vault

AI Layer: GitHub Copilot + Agent workflows

Tools, Node.js, Vscode, Git, SSMS, MSSQL

Domain: Lending/Loan life cycle, Collateral tracking etc.

Salary Range- $100,000-$120,000 a year

#LI-SP3

#LI-VX1

Location

Dallas, TX

Job Function

TECHNOLOGY

Role

Engineer

Job Id

421293

Desired Skills

React

Salary Range

$100,000-$120,000 a year

Compensation

This Frontend Engineer role pays $100k-$120k/yr. Within typical range for frontend engineer roles in United States.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Frontend Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Frontend Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.

Start freeReport this listing