UI Developer

NTT DATA

Gurugram, INonsitePosted Jul 10, 2026
Posting intelligenceActively listedReposted 18×, possible evergreen/ghost posting

Skills

javascripttypescriptreacthtmlfigmacssaws

About the role

Req ID: 377789

We are currently seeking a UI Developer to join our team in Gurgaon, Haryāna (IN-HR), India (IN).

Job Summary:

We are seeking a highly skilled Senior UI Developer with 8+ years of experience in designing and building modern, scalable, and high-performance user interfaces. The ideal candidate should have deep expertise in React, TypeScript, HTML, CSS, and Micro Frontend Architecture, along with strong experience integrating with .NET Core backend services, REST APIs, and working in cloud-native environments on AWS Infrastructure. Experience with Figma, AI coding assistants, MCP servers, and semantic data technologies such as RDF, SPARQL, SHACL, as well as exposure to FIBO/CDM frameworks, is highly desirable.

Key Responsibilities:

Design, develop, and maintain scalable, reusable, and high-performance UI applications using React, TypeScript, HTML5, and CSS3

Build responsive and accessible user interfaces aligned with business and user experience goals

Translate Figma designs into pixel-perfect, production-ready front-end applications

Implement and manage Micro Frontend Architecture for large-scale enterprise platforms

Integrate front-end applications with .NET Core backend systems and REST APIs

Collaborate with UX/UI designers, backend developers, product owners, and cloud/DevOps teams

Develop modular components, shared libraries, and design-consistent UI systems

Optimize frontend performance, application scalability, and maintainability

Work with AWS Infrastructure teams to support deployment, hosting, monitoring, and frontend delivery strategies

Leverage AI coding assistants to improve productivity, code quality, and development efficiency

Work with MCP servers and advanced integration ecosystems where applicable

Contribute to solutions involving semantic and knowledge-driven technologies using RDF, SPARQL, and SHACL

Support domain-aligned UI/data implementations involving FIBO/CDM frameworks

Participate in architecture reviews, code reviews, technical design discussions, and sprint planning

Ensure adherence to engineering standards, accessibility guidelines, security best practices, and UI governance

Required Skills and Qualifications:

8+ years of experience in UI/front-end development

Strong expertise in React.js and TypeScript

Strong hands-on experience with HTML5, CSS3, JavaScript, responsive design, and cross-browser compatibility

Experience integrating UI applications with REST APIs

Solid understanding of .NET Core from an integration and application ecosystem perspective

Strong experience with Figma and converting design systems/wireframes into production-ready UI

Hands-on experience with Micro Frontend Architecture

Working knowledge of AWS Infrastructure relevant to frontend applications, deployment patterns, and hosting environments

Familiarity with AI Coding Assistants and their practical use in modern software development workflows

Experience working with MCP Servers

Exposure to RDF, SPARQL, and SHACL for semantic data modeling and validation

Understanding of FIBO/CDM frameworks and their application in domain-driven solutions

Good understanding of frontend architecture, state management, component lifecycle, and reusable UI patterns

Experience with version control tools such as Git

Strong understanding of software engineering best practices, code quality, testing, and documentation

Experience working in Agile/Scrum teams

About NTT DATA

NTT DATA is a $30 billion business and technology services leader, serving 75% of the Fortune Global 100. We are committed to accelerating client success and positively impacting society through responsible innovation. We are one of the world's leading AI and digital infrastructure providers, with unmatched capabilities in enterprise-scale AI, cloud, security, connectivity, data centers and application services. our consulting and Industry solutions help organizations and society move confidently and sustainably into the digital future. As a Global Top Employer, we have experts in more than 50 countries. We also offer clients access to a robust ecosystem of innovation centers as well as established and start-up partners. NTT DATA is a part of NTT Group, which invests over $3 billion each year in RD.

Whenever possible, we hire locally to NTT DATA offices or client sites. This ensures we can provide timely and effective support tailored to each client’s needs. While many positions offer remote or hybrid work options, these arrangements are subject to change based on client requirements. For employees near an NTT DATA office or client site, in-office attendance may be required for meetings or events, depending on business needs. At NTT DATA, we are committed to staying flexible and meeting the evolving needs of both our clients and employees. NTT DATA recruiters will never ask for payment or banking information and will only use @nttdata.com, @nttdatafed.com and @talent.nttdataservices.com email addresses. If you are requested to provide payment or disclose banking information, please submit a contact us form, https://us.nttdata.com/en/contact-us.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Software Engineer roles in India varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer hub for India medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.