Senior Python Developer (Backend)

Protolabs

Amsterdam, NLhybridPosted Jul 9, 2026
Posting intelligenceActively listed

Skills

postgreskubernetestypescriptsqlalchemyterraformangulardockergithubpythonflaskredisc++cicdrustjavaaws

About the role

Be yourself at Protolabs

Why Protolabs?

We are the leaders in digital manufacturing. We hire doers, makers, and creative thinkers who tackle our roles with an entrepreneurial spirit. Our culture is centered around meaningful work that brings new and innovative products to market at unprecedented speeds. We are a diverse team that comes from all walks of life and take pride in our team who is smart, genuine, humble, and passionate about what we do. It’s our people who fuel our creativity and make our culture feel like home.

We are looking for a Senior Python Developer to join our team in AMS!

This is a hybrid role, and we are accepting applications from candidates based in the Netherlands.

The Manufacturing Partner Marketplace is the operational heart of Protolabs Network. We own the full order lifecycle - matching orders to the right manufacturing partners, moving them through production and quality control, and ensuring on-time delivery. Our work is critical to maintaining seamless operations and customer satisfaction.

Within this domain you'll be building systems that power the marketplace - automated auctions, order allocation, supplier tooling, production workflows, global logistics, quality control, and internal ops tools. We are looking for a pragmatic problem solver who will thrive in a dynamic environment and can take ownership of the business problem, not just the technical solution.

Our Tech Stack

Backend: Python 3.11+ with FastAPI, Flask and SQLAlchemy (we also use Celery with RabbitMQ for background tasks and KNative for eventing)

Frontend: Angular 15 with TypeScript

DevOps: Kubernetes on AWS (using EKS), Terraform, GitHub Actions

Data: PostgreSQL (on RDS), Redis (using Elasticache)

Integrations: Retool and Zapier

(Some teams also use Rust, Java, and C++)

What you’ll do

Lead the design and delivery of features end to end, working cross-functionally with stakeholders to solve complex marketplace problems

Build APIs and backend systems that power the order lifecycle from supplier matching to delivery

Drive architectural decisions and improve the technical foundations of our platform

Mentor engineers and raise the bar on engineering practices within the team

Integrate with eventing systems and scale our platform as order volume grows

Improve the quality of our products through testing, observability, and best practices

Collaborate with our Backend guild to set standards and improve the state of our backend systems.

What you’ll bring

7+ years of experience building web applications and backend services

Strong proficiency in Python for designing, developing, testing and monitoring production systems

Experience with relational databases like PostgreSQL

Experience with Docker, Kubernetes, and CI/CD environments

Track record of leading technical projects and mentoring other engineers

Experience working in an agile team with product managers and designers

Excellent communication and collaboration skill

Bonus Points For

Experience with marketplace platforms or operational systems

Deep understanding of event-based architectures

Familiarity with Angular

What's in it for you?

Part of our incredible journey is clearly down to our amazing team, and we strongly believe in giving people a space to truly, authentically be themselves. We also believe that treating our employees well and sprinkling a great place to work with some nice perks can make work a little sweeter.

Annual company bonus. We celebrate success together! Employees are not only rewarded for their achievements but also for contributing to the overall success of the business.

Wellness and well-being with access to OpenUp psychologists, practice mindfulness with Headspace and tons more.

Doggo-friendly office. We are big pet lovers and fully encourage hanging out with your (and your colleagues’) furry friends in the office

Daily Lunch and snacks are provided in the office; it's a moment for our teams to connect and recharge. Shared meals strengthen our bonds and fuel collaboration.

We offer learning and development days to be used for training or on volunteering, money to spend on learning courses, events, trainings, Access to our in-house LEARN platform with diverse courses, training, and workshops, In-house 3D Printing and much more!

Follow us on Instagram to see what Life at Protolabs is all about!

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Backend Engineer roles in Netherlands varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Backend Engineer hub for Netherlands medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.