Software Engineer

Nike

USonsitePosted Jul 3, 2026
Posting intelligenceActively listed

Skills

cloudformationpostgresconfluencekubernetessalesforcedatabricksjavascripttypescriptsnowflaketerraformairflowjenkinsdockergithubpythonkafkamysqlmssqlreactcicdawscssllmml

About the role

Who We Are Looking For

We’re looking for a Full Stack Software Engineer II who thrives at the intersection of innovation and execution. You’re a builder at heart—comfortable working across the stack, passionate about clean code, and driven by delivering scalable, high-impact solutions. You’ll join a team that’s shaping the future of digital experiences at Nike, leveraging modern technologies to solve complex business challenges.

What You Will Work On

As a Full Stack Software Engineer II, you will:

Participating in architectural design sessions with the team’s engineers

Developing and document REST API contract specifications in Confluence

Developing REST APIs in Python utilizing the FastAPI framework

Build and optimize data pipelines and services using Databricks, PostgreSQL, and Snowflake.

Design, develop, and deploy scalable web applications using React, HTML, Python and SQL.

Develop and maintain cloud-native applications on AWS.

Utilizing infrastructure as code practices to provision cloud resources

Building and maintaining CI/CD build pipelines in Jenkins

Participating in engineer code reviews via GitHub

Assisting in the story breakdown to convert architecture designs into executable tasks

Developing data integrations using Airflow, Snowflake and Apache Kafka

Who You Will Work With

You’ll be part of a cross-functional team of engineers, business stakeholders, and product owners. You’ll also collaborate with stakeholders across Legal, Compliance, and Enterprise Platforms to deliver solutions that are secure, scalable, and aligned with Nike’s digital strategy.

What You Bring

Bachelor’s degree in computer science, information systems or related field. Will accept any suitable combination of education, experience and training.

2+ years’ experience developing cloud native REST APIs

2+ years’ experience utilizing AWS cloud infrastructure

2+ years’ experience developing services in Python.

2+ years’ experience utilizing message-based solutions (SQS, Kafka, RabbitMQ)

2+ years’ experience in building Front end applications using React and modern JavaScript/TypeScript frameworks and develop views using HTML/CSS

Hands-on experience with Databricks and Snowflake

Experience with SQL and relational databases like PostgreSQL, MYSQL or MSSQL

Experience working with Docker and/or Kubernetes

Experience with infrastructure as code (CloudFormation, Terraform, AWS SAM)

Experience working with business stakeholders and product managers to drive requirements

Experience in an Agile or Scrum development environment, including a demonstrated ability to deliver software applications in this environment

Proven ability to deliver highly integrated software applications with complex dependencies

Proven experience as a member of a large project / project team

Outstanding collaboration, listening, written and verbal communication skills

High tolerance for ambiguity and changing priorities

Exposure to Generative AI and LLM-based applications

Exposure to AI/ML pipelines or model integration

Prior experience in the Legal domain or working with legal/compliance systems

Familiarity with MLOps or deploying ML models in production

Familiarity with Salesforce APIs

Experience with ETL tools like Apache Airflow etc.

Strong problem-solving and analytical skills

Excellent communication and collaboration abilities

A growth mindset and a passion for continuous learning

Cross collaboration with teams located in different geographies

We offer a number of accommodations to complete our interview process including screen readers, sign language interpreters, accessible and single location for in-person interviews, closed captioning, and other reasonable modifications as needed. If you discover, as you navigate our application process, that you need assistance or an accommodation due to a disability, please complete the Candidate Accommodation Request Form.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Software Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.