Software Engineer - Front End Angular (TS/SCI Clearance Required)

North Point Technology

USonsitePosted Jul 1, 2026
Posting intelligenceActively listedReposted 4×, possible evergreen/ghost posting

Skills

cloudformationkubernetesjavascripttypescriptplaywrightterraformangularcypressdockerhtmlazurekafkacssjestgooglecloudaws

About the role

This job requires active TS/SCI clearance. Please apply only if you have an active TS/SCI clearance.

North Point Technology is looking for a TS/SCI Cleared Software Engineers to support a critical mission. The GEOINT Collection neXt (GCX) Program, awarded May 25 as a 7-year contract, is dedicated to sustaining and advancing the GEOINT Information Management Services (GIMS) system. GIMS is a mission-critical enterprise platform that acts as the primary gateway for submitting and adjudicating GEOINT Information Needs (GINs) and related requirements. It enables users to search, discover, and retrieve imagery and other GEOINT data, while centrally managing collection, exploitation, dissemination, and production tasks across a broad network of commercial and national providers.

The program employs DevSecOps and Agile practices, emphasizing communication, collaboration, integration, automation, and performance measurement between software developers and IT professionals. Above all, the program prioritizes operational stability.

Responsibilities:

Build and ship responsive Angular/TypeScript features, turning product and UX designs into accessible, high-performance components. Own key UI architecture decisions (components, state, routing, performance), integrate with REST/GraphQL services, and deliver clean, well-tested code. Partner closely with Product, Design, and Backend Engineering, troubleshoot production issues with root-cause fixes, participate in code reviews, and improve pipelines and developer tooling. Document decisions and implementations to keep the codebase maintainable.

Required Qualifications:

TS/SCI Clearance

BS in Software Engineering or related field

2-10 years of professional software engineering experience focused on front-end development

Strong, hands-on expertise with Angular (components, modules, routing, forms, RxJS)

Proficiency in TypeScript, modern JavaScript (ES6+), HTML5, and CSS/SCSS

Experience building reusable component libraries/design systems and consistent UI patterns

Solid understanding of SPA architecture, client-side performance, and web fundamentals

Experience consuming APIs (REST and/or GraphQL), handling auth/session patterns, and error states

Experience with automated testing (Jasmine/Jest, Karma, Cypress/Playwright, or similar)

Familiarity with Git workflows and collaborating via code reviews in a team environment

Ability to work from ambiguity and deliver reliable, user-focused solutions

Preferred Qualifications:

Experience with distributed systems and event streaming (Kafka, RabbitMQ, or similar)

Familiarity with geospatial, ISR, or intelligence-domain data pipelines that map to TCPED stages

Experience with cloud-native deployments (Docker, Kubernetes, AWS/Azure/GCP)

Experience with API security and enterprise auth (OAuth2/OIDC, mTLS, RBAC/ABAC)

Experience with performance profiling and tuning for JVM-based services

Exposure to IaC (Terraform/CloudFormation) and platform automation

Mentoring or leading small technical efforts (design reviews, refactors, standards adoption)

North Point Technology is THE BEST place to work for curious-minded engineers motivated to support our country's most crucial missions! We focus on long term projects, leveraging the latest technology in support of innovative solutions to solve our customer's most difficult problems.

At North Point Technology, EMPLOYEES come first! We value our employees by providing excellent compensation, benefits, and a flexible work-life balance. We strive for a close-knit and open atmosphere where the owners are always directly available to our team members.

Come join us! Apply with North Point Technology today!

For positions requiring a federal security clearance, your clearance level must be clearly identified on your resume.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Frontend Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Frontend Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.