Senior SDET

Qode

Austin, UShybridPosted Jul 1, 2026
Posting intelligenceActively listedReposted 3×, possible evergreen/ghost posting

Skills

azure devopspostgreskubernetessqlalchemyplaywrightseleniumjenkinsdockergithubpythonflaskazureredisreactcicdjavaaws

About the role

Company: Incedo

Position: Senior SDET

Locations: Fort Mill, SC | Austin, TX | New York, NY (Hybrid)

Type: Full-Time

Company Overview

Incedo is a US-based consulting, data science, and technology services firm with 4,000+ professionals across the US, Mexico, and India. We help clients achieve competitive advantage through end-to-end digital transformation, combining engineering excellence, data science, and design with deep domain expertise across Telecom, Banking, Wealth Management, Product Engineering, and Life Sciences & Healthcare.

Role Description

As part of our growing Quality Engineering practice, we are seeking a passionate and experienced Senior Software Development Engineer in Test (SDET) to support a strategic engagement within the Wealth Management domain. You will contribute to next-generation digital platforms that empower financial advisors and investors with smarter decision-making tools and exceptional client experiences.

This role is ideal for engineers who enjoy building robust automation frameworks, solving complex quality challenges, and driving engineering excellence. You will design and implement automation frameworks end-to-end, collaborate closely with engineering and product teams, and embed quality practices throughout the development lifecycle.

Roles & Responsibilities

Design and implement automation frameworks end-to-end using Java and Python.

Build scalable UI, API, and end-to-end automation solutions using Playwright and Selenium.

Develop reusable libraries, utilities, and modular components to support automation at scale.

Collaborate with engineering, product, and DevOps teams to translate requirements into robust test solutions.

Integrate automated tests into CI/CD pipelines using Git-based workflows and tools such as Jenkins, GitHub Actions, or Azure DevOps.

Execute, maintain, and optimize automated test suites for reliability and performance.

Perform code reviews and ensure adherence to automation best practices and clean coding standards.

Debug complex issues across distributed systems and microservices.

Create and maintain documentation for frameworks, test strategies, and engineering standards.

Support shift-left testing practices and early defect detection.

Contribute to continuous improvement of quality engineering processes and tooling.

Qualifications

8–12+ years of experience in software testing, automation, and quality engineering

Bachelor’s or Master’s degree in Computer Science, Engineering, or related field (preferred)

Technical Skills (Required)

Java & Python programming expertise

End-to-end automation framework development (architecture, abstraction, interfaces, dependency injection, configuration management)

Playwright & Selenium for UI automation

API automation (REST, JSON, schema validation, integration flows)

Experience with parallel execution concepts (TestNG or equivalent patterns)

Solid understanding of Agile/Scrum and shift-left testing practices

CI/CD integration with Git-based workflows

Git for version control and branching strategies

Debugging & problem solving across distributed systems

Experience designing automation frameworks from scratch and owning them end-to-end

Technical Skills (Preferred)

AWS (Lambda, S3, EC2, CloudWatch, IAM, etc.)

Docker & Kubernetes for containerized test execution and microservice environments

Microservices testing (service isolation, contract testing, distributed debugging)

Nice to have:

Financial Services / Wealth Management / Banking domain experience

Flask, FastAPI, React, SQLAlchemy, PostgreSQL, Redis

Splunk

XCUITest, Appium, TestNG-specific expertise (beyond general concepts)

OpenCAFE

AI tooling

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Software Engineer in Test roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer in Test hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.