Sr Associate Engineer/Engineer, IT Software

American Airlines

Phoenix, USonsitePosted Jun 29, 2026
Posting intelligenceActively listed

Skills

azure devopspostgreskubernetesjavascripttypescriptplaywrightterraformseleniummongoangularcypressdockergithubpytestazurekafkaredisreactjunitcicdawsc#

About the role

Intro

Are you ready to explore a world of possibilities, both at work and during your time off? Join our American Airlines family, and you’ll travel the world, grow your expertise and become the best version of you. As you embark on a new journey, you’ll tackle challenges with flexibility and grace, learning new skills and advancing your career while having the time of your life. Feel free to enrich both your personal and work life and hop on board!

Why you'll love this job

As one diverse, high-performing team dedicated to technical excellence, you will focus relentlessly on delivering unrivaled digital products that drive a more reliable and profitable airline.

The Software domain refers to the area within Information Technology that focuses on the development, deployment, management, and maintenance of software applications that support business processes and user needs. This includes development, application lifecycle management, requirement analysis, QA, security & compliance, and maintaining the applications and infrastructure.

What you'll do

As noted above, this list is intended to reflect the current job but there may be additional essential functions (and certainly non-essential job functions) that are not referenced. Management will modify the job or require other tasks be performed whenever it is deemed appropriate to do so, observing, of course, any legal obligations including any collective bargaining obligations.

Writes, tests, and documents technical work products (e.g., code, scripts, processes) according to organizational standards and practices

Consistently produces good quality technical work products that are clear, concise, tested, and easily understood by others

Efficiently debugs design-time and run-time problems and effectively identifies problems in dependencies or caused by interactions with other services

Designs new implementations and provides enhancements to existing architectures, maintaining reliability, resiliency, security, and performance

Identifies and corrects issues with system components affecting operational reliability, stability and performance based on observable telemetry

Understands and follows secure coding practices to avoid known potential vulnerabilities and actively looks for vulnerabilities during code reviews

Identifies opportunities for automation that improve team performance and raises them to the team

Consistently identifies and capitalizes on opportunities for simplification

All you'll need for success

Minimum Qualifications- Education & Prior Job Experience

Bachelor's degree in Computer Science, Computer Engineering, Technology, Information Systems (CIS/MIS), Engineering or related technical discipline, or equivalent experience/training

1+ years of experience designing, developing, and implementing large-scale solutions in production environments

Preferred Qualifications- Education & Prior Job Experience

Master's degree in Computer Science, Computer Engineering, Technology, Information Systems (CIS/MIS), Engineering or related technical discipline, or equivalent experience/training

Airline Industry experience

Skills, Licenses & Certifications

Experience with the following technologies:

Programming Languages: C#, Javascript/Typescript, Terraform

Frameworks: FastAPI

Front End Technologies: Angular/React

Compute Technologies: Kubernetes, App Services

Deployment Technologies: Kubernetes, Docker

Source Control: GitHub, Azure DevOps

CICD: GitHub Actions, Azure DevOps

Data management: CosmosDB, PostgreSQL, MongoDB, Redis, MS SQL

Integration/APIs Technologies: Kafka, REST, GraphQL

Cloud Providers: Azure and AWS

Test Automation: Selenium, TestNG, Postman, SonarQube, Cypress, JUnit/NUnit/PyTest, Cucumber, Playwright, Wiremock/Mockito/Moq

Ability to concisely convey ideas verbally, in writing, in code, and in diagrams

Experience in Agile methodologies, such as SCRUM

Experience in DevOps Toolchain methodologies, including Continuous Integration and Continuous Deployment

What you'll get

Feel free to take advantage of all that American Airlines has to offer:

Travel Perks: Ready to explore the world? You, your family and your friends can reach 365 destinations on more than 6,800 daily flights across our global network.

Health Benefits: On day one, you’ll have access to your health, dental, prescription and vision benefits to help you stay well. And that’s just the start, we also offer virtual doctor visits, flexible spending accounts and more.

Wellness Programs: We want you to be the best version of yourself – that’s why our wellness programs provide you with all the right tools, resources and support you need.

401(k) Program: Available upon hire and, depending on the workgroup, employer contributions to your 401(k) program are available after one year.

Additional Benefits: Other great benefits include our Employee Assistance Program, pet insurance and discounts on hotels, cars, cruises and more

Feel free to be yourself at American

From the team members we hire to the customers we serve, inclusion and diversity are the foundation of the dynamic workforce at American Airlines. Our 20+ Employee Business Resource Groups are focused on connecting our team members to our customers, suppliers, communities and shareholders, helping team members reach their full potential and creating an inclusive work environment to meet and exceed the needs of our diverse world.

Are you ready to feel a tremendous sense of pride and satisfaction as you do your part to keep the largest airline in the world running smoothly as we care for people on life’s journey? Feel free to be yourself at American.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Software Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.