Lead Software Engineer, AI & Emerging Tech

CPP Investments | Investissements RPC

Toronto, CAonsite$163k-$255k/yrPosted Jun 29, 2026
Posting intelligenceActively listedReposted 2×, possible evergreen/ghost posting

Skills

confluencematplotlibjavascripttypescriptplaywrightterraformlangchainseleniumtableaufargateairflowworkdaynextdockerpandaspythonnumpyneo4jreactjiraawsllmml

About the role

Purpose. Performance. People.

Joining CPP Investments means joining one of the world’s most admired and respected institutional investors to drive a single mandate: to deliver strong, sustainable returns for generations of Canadians.

With a long-term horizon and global reach, we deploy capital at scale across public and private markets. Our size, stability, and disciplined investment philosophy allow us to pursue complex opportunities and build enduring partnerships worldwide.

For our people, this means meaningful work with tangible impact, real opportunity, and collaboration with exceptional colleagues who value partnership and performance. Here, you’ll contribute to outcomes that matter alongside team members committed to excellence and shared success.

Role Summary:

As a Lead Engineer for AI & Emerging Tech, you will drive the design, development, and deployment of next-generation tech and AI-powered solutions that unlock business value across the organization. This is a hands-on, coding-intensive leadership role, where you will code, architect, pilot and build robust solutions, mentor engineers, and push the boundaries of what’s possible with AI, AWS cloud, and emerging technologies.

You’ll partner with cross-functional teams to identify high-impact use cases, lead agile engineering sprints, and ensure solutions are secure, scalable, and aligned with organizational goals. The ideal candidate is a senior engineer passionate about coding, with deep expertise in python, emerging tech, cloud infrastructure, and AI/ML - and thrives in a fast-paced, exploratory environment.

Accountabilities & Qualifications:

As a Lead Software Engineer, you will guide and participate in building and supporting value-add technology solutions and products end-to-end. You will also demonstrate leadership and drive engineering excellence within your team and influence the same across the Technology & Data department.

Accountabilities

Lead and actively contribute to the development of AI products, pilots and solutions, with a focus on clean, maintainable code using Python, React, and AWS tools.

Design, architect and build scalable Gen AI solutions, including LLM pipelines, Agentic, MCP, Graph/RAG architectures, and prompt-based applications and emerging tech.

Implement cloud-native solutions using AWS services such as EKS, Lambda, Fargate, Glue, and Athena.

Optimize performance of AI products, Drive continuous learning and experimentation with cutting-edge Gen AI methods, frameworks, APIs, and toolchains.

Work closely with product managers, data scientists, and domain experts to define technical solutions aligned with business needs.

Act as a subject matter expert (SME) on Gen AI technologies and help shape the organization's AI roadmap.

Own end-to-end delivery of Gen AI solutions. Manage timelines, deliverables, and project milestones using Agile practices (Scrum/Kanban).

Monitor operational metrics and incident data to drive continuous improvement and reliability.

Ensure adherence to governance, DevSecOps protocols.

Qualifications

Bachelor’s degree in computer science, engineering, or a related field; advanced degrees or certifications are an asset.

6+ years of progressive experience in engineering roles, including at least 1-2 years leading emerging tech or AI initiatives.

Experience in:

Gen AI models (GPT, Claude, Gemini, Copilot) and prompt engineering techniques

Agentic AI, MCP, and Graph/RAG architectures

Gen AI Framework (Amazon Bedrock, LangChain, LlamaIndex, Hugging Face, PandsAI)

Web application development using Next.js, React, TypeScript/JavaScript

AWS cloud services (EC2, ELB/GLB/NLB, EKS, Fargate, Lambda, Athena, Glue, Lake Formation)

Infrastructure as Code (Puppet, Terraform, Docker) and containerized deployments

ETL orchestration using Apache Airflow/DAGs

Vector/Graph databases (Weaviate, Milvus, PGVector, Neo4J, Neptune) and query optimization

Python programming (NumPy, Pandas, Matplotlib, Boto3)

Automated testing frameworks (Ragas, Playwright, Zephyr, Selenium,)

Familiarity with SDLC best practices, DevSecOps, Agile Scrum/Kanban, and work management tools (JIRA, Confluence, JIRA Align).

Knowledge of LLM fine tuning techniques

Experience in BI tools like QuickSight, Tableau, and knowledge of financial markets and enterprise data systems

For candidates applying to the New York posting: The salary range for this position is $163,000 to $255,000.

US state/city legislation requires CPP investments to include a reasonable estimate of the compensation range for this role. The base salary range shown here is a reasonable expectation for the posted role and is part of a competitive total rewards package which includes comprehensive benefits, a performance-based incentive plan, a 401 (k) plan and paid time off. Actual salaries may vary and may be above or below the range based on various factors , including, but not limited to, experience and expertise .

You are motivated to contribute to something larger than yourself, approach complex challenges with rigor, and hold yourself to high standards in a collaborative, performance-driven environment.

We provide colleagues with cutting-edge AI tools, dedicated learning time, and practical support to help them deliver with greater impact.

Inclusion & Accessibility

CPP Investments is committed to equitable access to employment and building a workforce that reflects diverse talent and perspectives. If you require accommodation at any stage of the recruitment process, please let us know and we will work with you to meet your needs.

Attention: Protect Yourself from Fraud

CPP Investments is committed to a secure and transparent recruitment process. We will never ask candidates for payment or financial information at any stage of hiring. All legitimate opportunities are posted on our careers page, and communications will come from our applicant tracking system, Workday.

CPP Investments may use AI tools to help screen and assess applicants by analyzing resumes and applications for relevant skills and experience. These tools support, but do not replace, human decision-making.

#LI-ONSITE

Compensation

This Software Engineer role pays $163k-$255k/yr. Within typical range for software engineer roles in Canada.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Software Engineer roles in Canada varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer hub for Canada medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.