UI/UX Engineer

Leidos

USonsite$131k-$237k/yrPosted Jun 24, 2026

Skills

javascriptangulargrafanasketchfigmareactcicdcsstypescriptml

About the role

Description

Primary Responsibility

Creating, prototyping, and coding seamless user interfaces for mission-critical government systems that leverage AI/ML technologies. Working seamlessly across unclassified and classified (TS/SCI) systems

Ensure high-security software remains intuitive, efficient, and accessible for federal stakeholders and analysts.

UI/UX Design & Implementation: Design and develop intuitive, responsive user interfaces for web-based applications

User Experience Optimization: Translate complex workflows into simple, efficient user experiences that improve usability and adoption

Front-End Development: Build and maintain front-end components using modern frameworks (e.g., React, Angular, or similar)

Usability & Accessibility: Ensure applications meet usability standards and accessibility best practices

Design Systems: Contribute to and maintain consistent design patterns, components, and style guides

User Research & Feedback: Gather and incorporate user feedback to continuously improve interface design and functionality

Cross-Functional Collaboration: Work closely with backend engineers, product teams, and stakeholders to align UI/UX with system capabilities

Performance Optimization: Improve front-end performance, responsiveness, and scalability

Create interfaces that streamline complex data visualization and integrate seamlessly with AI-driven capabilities.

Collaborate heavily with back-end, data science, and AI/ML teams to ensure technical feasibility and smooth integration.

Work fluidly across multiple security domains (NIPRNet, SIPRNet, and JWICS or equivalent classified networks).

Qualifications

TS/SCI w/Polygraph

Must be a US Citizen

Typically requires BS degree and 12 – 15 years of prior relevant experience or Masters with 10 – 13 years of prior relevant experience. May possess a Doctorate in technical domain. Experience may be exchanged for degree requirements.

Ability to conduct user research, stakeholder interviews, and usability testing to deeply understand the needs of defense and intelligence personnel.

Ability to translate user needs to create functionally designed interfaces that streamline complex data visualization and integrate seamlessly with AI-driven capabilities.

Strong experience with front-end technologies (JavaScript, HTML, CSS)

Experience with modern UI frameworks (React, Angular, etc.)

Demonstrated experience designing user-centered interfaces for complex applications

Understanding of UX principles, usability, and interaction design

Collaborate heavily with back-end, data science, and AI/ML teams to ensure technical feasibility and smooth integration.

Work fluidly across multiple security domains (NIPRNet, SIPRNet, and JWICS or equivalent classified networks).

Preferred Qualifications

Experience with design tools (Figma, Sketch, Adobe XD)

Experience with data visualization tools (e.g., Grafana or similar)

Familiarity with REST APIs and backend integration

Exposure to CI/CD pipelines and front-end deployment workflows

Experience working in Agile environments

Experience designing and developing intuitive user interfaces for data-driven GEOINT applications.

If you're looking for comfort, keep scrolling. At Leidos, we outthink, outbuild, and outpace the status quo - because the mission demands it. We're not hiring followers. We're recruiting the ones who disrupt, provoke, and refuse to fail. Step 10 is ancient history. We're already at step 30 - and moving faster than anyone else dares.

Original Posting:

June 24, 2026

For U.S. Positions: While subject to change based on business needs, Leidos reasonably anticipates that this job requisition will remain open for at least 3 days with an anticipated close date of no earlier than 3 days after the original posting date as listed above.

Pay Range:

Pay Range $131,300.00 - $237,350.00

The Leidos pay range for this job level is a general guideline only and not a guarantee of compensation or salary. Additional factors considered in extending an offer include (but are not limited to) responsibilities of the job, education, experience, knowledge, skills, and abilities, as well as internal equity, alignment with market data, applicable bargaining agreement (if any), or other law.

About Leidos

Leidos is an industry and technology leader serving government and commercial customers with smarter, more efficient digital and mission innovations. Headquartered in Reston, Virginia, with 47,000 global employees, Leidos reported annual revenues of approximately $16.7 billion for the fiscal year ended January 3, 2025. For more information, visit www.Leidos.com.

Pay and Benefits

Pay and benefits are fundamental to any career decision. That's why we craft compensation packages that reflect the importance of the work we do for our customers. Employment benefits include competitive compensation, Health and Wellness programs, Income Protection, Paid Leave and Retirement. More details are available at www.leidos.com/careers/pay-benefits.

Securing Your Data

Beware of fake employment opportunities using Leidos’ name. Leidos will never ask you to provide payment-related information during any part of the employment application process (i.e., ask you for money), nor will Leidos ever advance money as part of the hiring process (i.e., send you a check or money order before doing any work). Further, Leidos will only communicate with you through emails that are generated by the Leidos.com automated system – never from free commercial services (e.g., Gmail, Yahoo, Hotmail) or via WhatsApp, Telegram, etc. If you received an email purporting to be from Leidos that asks for payment-related information or any other personal information (e.g., about you or your previous employer), and you are concerned about its legitimacy, please make us aware immediately by emailing us at LeidosCareersFraud@leidos.com.

If you believe you are the victim of a scam, contact your local law enforcement and report the incident to the U.S. Federal Trade Commission.

Commitment to Non-Discrimination

Compensation

This Software Engineer role pays $131k-$237k/yr. Within typical range for software engineer roles in United States.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Software Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, LinkedIn Easy Apply, and most other ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.