Full Stack Developer

neutron

Singapore, SGonsite$84k-$102k/yrPosted Jun 19, 2026
Posting intelligenceActively listedReposted 24×, possible evergreen/ghost posting

Skills

cloudformationpostgresconfluencekubernetesprometheusjavascripttypescripttimeseriesplaywrightexpressterraformtailwindreactangulardatadogcypressnextnodespringdockeroraclegitlabpulumisentrypython

About the role

Role Details & Requirements

1. Senior Full Stack Engineer (SharePoint & .NET)

7+ years of software engineering experience

Backend: .NET/C#, ASP.NET, RESTful APIs, MSSQL/SQL Server

Frontend: JavaScript, modern frameworks (Angular, Vue, React)

SharePoint 2019 / Subscription Edition – development, administration, migrations

Workflow automation (Nintex Workflow & Forms)

Azure GCC / Government Cloud environment experience

CI/CD pipelines, DevOps, code quality tools (SonarQube)

2. Full Stack Software Engineer – GenAI Platforms

Drive development of a Whole-of-Government Chat platform incorporating LLM integrations, RAG, and semantic search.

5–7+ years in web application development

Node.js, TypeScript – strong hands-on proficiency

Cloud platforms: Azure / AWS / GCP; CI/CD; Docker

Experience with LLM integrations (Azure OpenAI, OpenAI APIs)

RAG architectures, vector databases, semantic search

AI system governance, evaluation frameworks, responsible AI

Agile tech lead experience; mentoring and coaching capability

3. Senior Full Stack Engineer – V3 Project (Next.js / Maps)

Build data-driven web platforms with interactive geospatial maps and high-performance data visualisation for environmental services.

5+ years full stack experience

Strong in Next.js, React, TypeScript – production experience required

RESTful API development and integration

Interactive map libraries: Leaflet, MapLibre, or similar

Data-driven UI: charts, dashboards, dynamic controls

Performance optimisation for data-heavy applications

Plus: geospatial concepts (CRS, raster, tiles), NetCDF/GeoTIFF

4. Full Stack Engineer – (SharePoint & Cloud Migration)

Support, develop, and migrate enterprise SharePoint solutions and .NET applications to Government Cloud environments.

SharePoint Online and On-Premises (administration, configuration, support)

SharePoint migration projects (On-Premises to Cloud / GCC)

ASP.NET / .NET development and integration

Microsoft SQL Server – queries, administration, troubleshooting

Microsoft Entra ID (Azure AD), REST APIs, Microsoft 365 ecosystem

Plus: Power Platform (Power Apps, Power Automate, Power BI)

Plus: IM8 compliance, government security and governance awareness

5. Full Stack / Data Engineer – Station Data Platform

Design and build a high-performance cloud-based data ingestion and API platform for automatic weather station telemetry.

Strong backend engineering with high-throughput, cloud-based data platforms

Data ingestion pipelines: streaming, telemetry, sensor / IoT / time-series

Backend language proficiency: Python, Java, Go, or Node.js

Production-grade API design: REST, gRPC, or equivalent

Time-series databases, relational databases, data lakes

Performance tuning: partitioning, batching, backpressure, observability

Plus: cloud services, containerized deployments, CI/CD, IaC

Plus: environmental, geospatial, or industrial IoT data systems

6. Full Stack Engineer (Consultant) – Digital Services (3-Year Contract)

Support HPB's CIOO in delivering Whole-of-Government and national-level healthcare digital initiatives, including POC development, AI-assisted code workflows, and DevOps pipeline improvement.

Degree in IT, Computer Science, Computer Engineering, or related field

Minimum 4 years hands-on with Singapore Government Tech Stack (SGTS) – within the last 7 years

Minimum 4 years Agile delivery experience (Jira, Confluence, sprint-based)

Minimum 4 years Cloud Technology (AWS / GCC) architecture and deployment

Minimum 4 years delivering Singapore Government projects / products

Plus: AI development tools, code generation, automation experience

Plus: application operations, audit, Problem/Incident Management lifecycle

Plus: IM8 / Government security guidelines knowledge

Plus: Singapore healthcare sector domain knowledge

7. Full Stack Engineer – Gen-AI Assisted Procurement Application

Own end-to-end development of GenAI-assisted procurement-related web application, covering user engagement, frontend, backend, Azure cloud infrastructure, AI-assisted programming, DevOps, security, and quality assurance.

Strong full stack development across Next.js, TypeScript, React.js, UI component libraries (e.g., ShadCN, Tailwind CSS), APIs, and relational databases

Azure infrastructure experience including AKS, APIM, Key Vault, Managed Identities, Entra ID, Application Gateway, WAF, Blob Storage, and PostgreSQL Flexible Server

AI-assisted development experience with strong code review discipline to validate AI-generated code for logic, security, maintainability, and hallucinations

CI/CD using GitLab CI, Docker, Kubernetes, automated testing, observability, vulnerability scanning, and IM8 compliance awareness

Software Quality & Testing: Jest, Cypress, Playwright, Pact)

8. Senior Full Stack Engineer – Data Lake

Design, develop, deploy, and maintain scalable, high-performance, secure web applications for the Weather Data Lake programme, taking ownership across frontend, backend, cloud infrastructure, DevOps, QA, security, and observability.

Strong frontend and backend capability using JavaScript, TypeScript, React.js, Node.js, Express.js, NestJS, and RESTful APIs

Experience with CI/CD, Git workflows, Docker, Kubernetes, cloud platforms, and Infrastructure as Code tools such as Terraform, CloudFormation, or Pulumi

Security knowledge across CSP, CORS, XSS prevention, OAuth, JWT, API rate limiting, encryption, IAM, Secrets Management, and OWASP Top 10

Plus: observability tools such as Datadog, New Relic, Sentry, Prometheus, OpenTelemetry, ELK Stack, Loki, or Fluentd

9. Software Engineer (Consultant) – Regulatory Systems

Maintain and enhance mission-critical land titles and digital lodgement platforms, including STARS and ELS, while supporting legacy modernisation, operational resilience, regulatory compliance, and digital transformation.

3–5 years of software engineering, application maintenance, or enterprise system development experience

Strong programming and debugging skills in Java, JSP, JavaScript, SQL, PL/SQL, shell scripting, or related enterprise technologies

Experience with large, complex, or legacy systems, including production troubleshooting, tightly coupled business logic, and system integrations

Plus: Oracle, WebLogic, IIS, Tomcat, Spring Boot, Angular, AWS GCC, DevSecOps, observability, resiliency engineering, and regulated public sector environments

10. Software Engineer – Student Learning Space (SLS)

Build and modernise flagship Student Learning Space platform, developing scalable, high-impact digital learning experiences that connect industry partners, teachers, and students within Singapore’s education technology ecosystem.

3–5 years of professional software engineering experience, preferably in a full-stack role

Strong foundation in modern programming languages such as Python, Node.js, or Go, and frontend frameworks such as React or Vue

Experience with cloud-native architectures, microservices, Docker, Kubernetes, CI/CD tools, and high-availability deployments

Able to collaborate with Product Managers, UX Designers, Education Officers, and engineers to translate pedagogical and curriculum requirements into seamless digital experiences

Pay: $7,000.00 - $8,500.00 per month

Work Location: In person

Compensation

This Full-Stack Engineer role pays $84k-$102k/yr. Within typical range for full-stack engineer roles in Singapore.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Full-Stack Engineer roles in Singapore varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Full-Stack Engineer hub for Singapore medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.