Skip to content

Full Stack Software Engineer (NodeJS, React) - A26133

Activate Interactive Pte Ltd

Singapore, SGonsitePosted Jun 1, 2026

Skills

cloudformationpostgreskubernetesjavascripttypescriptplaywrightterraformseleniumreactfargatejenkinscypressnextnodedockergithubgitlabpythonvuefigmacicdjestawsecsllm

About the role

Activate Interactive Pte Ltd (“Activate”) is a leading technology consultancy headquartered in Singapore with a presence in Malaysia and Indonesia. Our clients are empowered with quality, cost-effective, and impactful end-to-end application development, like mobile and web applications, and cloud technology that remove technology roadblocks and increase their business efficiency.

We believe in positively impacting the lives of people around us and the environment we live in through the use of technology. Hence, we are committed to providing a conducive environment for all employees to realise their full potential, who in turn have the opportunity to continuously drive innovation.

We are searching for our next team members to join our growing team.

If you love the idea of being part of a growing company with exciting prospects in mobile and web technologies that create positive impact on people’s lives, then we would love to hear from you.

Co-Development Business Unit is hiring for Full Stack Software Engineer

You will work in Singapore Government Agencies

Internal Code: A26133

This is a fixed term contract role.

What will you do?

The Full Stack Engineer is responsible for designing, developing, deploying, and maintaining scalable, high-performance, and secure web applications. The role requires expertise in frontend and backend development, cloud technologies, DevOps automation, and application security. Engineers must work in an agile, DevOps-driven environment, ensuring high software quality, security, and maintainability.

Requirements

What are we looking for?

Proficient in database design and various databases (e.g. SQL, PostgreSQL, AWS S3, Athena, etc).

Familiar with W3C Document Object Model and customized web scraping (e.g. BeautifulSoup, react, CasperJS, PhantomJS, Selenium, Nodejs, etc).

Comfortable in at least one scripting language (eg. SQL, Python).

Proficient in building batch jobs (e.g. AWS Database Migration Services (DMS), Python, AWS Lambda, ECS Container task, Eventbridge, AWS Glue).

Knowledge about system design, data structure and algorithms.

Relevant working experience as a developer or equivalent in at least 3 Agile/ full project development life cycle and a minimum of 5 years’ experience in relevant

Strong proficiency in both frontend and backend development

Strong problem-solving skills and able to prioritise and manage multiple tasks

Ability to work both independently and as part of a team with professionals at all levels

Frontend Technologies:

JavaScript and TypeScript.

Frontend frameworks such as React.js, Next.js, Vue.js

Experience with wireframing and prototyping tools (Figma).

Backend Technologies:

Node.js

RESTful APIs, GraphQL, gRPC, and WebSockets for service communication.

Backend Scalability & API Design:

Strong experience in API design principles, including REST, GraphQL, gRPC, and

WebSockets.

Familiarity with backend service scalability strategies (horizontal scaling, autoscaling, load balancing).

DevOps, Cloud, and Infrastructure:

Experience with CI/CD pipelines (GitHub Actions, GitLab CI, ArgoCD, Jenkins).

Cloud solutioning and hand-on experience with AWS Cloud (ECS Fargate

containers, API Gateway, RDS PostgreSQL, Networking). Government Commercial

Cloud – GCC will be beneficial.

Experience with containerization and orchestration (Docker, Kubernetes).

Familiarity with Infrastructure as Code (IaC) tools (Terraform, CloudFormation)

Security Best Practices:

Strong knowledge of frontend security (CSP, CORS, XSS prevention).

Able to build Scripts and API Integrations with knowledge of JWT, JWKS, Cognito and Authorisers.

Familiarity with cloud security (IAM, Secrets Management, OWASP Top 10).

Software Quality & Testing:

Experience with unit and integration testing (Jest, Cypress, Playwright, Pact).

Backend testing using Postman, Supertest, contract testing.

Relevant experience in and knowledge of microservice architecture

Experience in working will LLM, e.g. Open AI, Amazon Q, Gemini

Familiarity with governance, adoption of digital services in enterprise IT environments.

Work experience and strong troubleshooting skills in resolving application

infrastructure (including desktop, server, network) and security related issues in a (Singapore) government environment.

Benefits

What do we offer in return?

Competitive Compensation: Market competitive salary and variable performance bonus aligned to your skills, impact, and contribution.

Benefits: Outpatient medical, specialist medical coverage and generous customisable flexi benefits, or flexi allowance; life and health insurance, thoughtful perks like special occasions “red packet” and CNY goodies, etc.

Employee Wellness: Support for your physical, mental, and overall well-being through year-round initiatives.

Growth & Development: Learning programmes, certification support, and a dedicated staff development budget. (We are a “SHRI 2025 Gold winner” in “Learning & Development; Coaching & Mentoring”)

Career Progression: Structured career pathways that enable you to grow along a technical/domain expert track or a leadership track.

Competency Framework: A structured and practical framework to support you to develop, perform, and succeed.

Flexible Work Arrangement: Staff may choose to work flexi-place, flexi-time, and flexi-load based on existing framework

Why you'll love working with us?

If you are looking for opportunities to collaborate with leading industry experts and be surrounded by highly motivated and talented peers, we welcome you to join us. We provide all employees with equal opportunities to grow and develop with us. We believe your success is our success.

Does it sound like something you are interested in exploring further? Please be in touch with our team for an initial chat.

Protecting your privacy and the security of your data are longstanding top priorities for Activate Interactive Pte Ltd.

Your personal data will be processed for the purposes of managing Activate Interactive Pte Ltd’s recruitment related activities, which include setting up and conducting interviews and tests for applicants, evaluating and assessing the results, and as is otherwise needed in the recruitment and hiring processes.

Please consult our Privacy Notice (https://www.activate.sg/privacy-policy) to know more about how we collect, use, and transfer the personal data of our candidates. Here you can find how you can request for access, correction and/or withdrawal of your Personal Data.

Questions about this role

  • How do I apply to this Full Stack Software Engineer (NodeJS, React) - A26133 role at Activate Interactive Pte Ltd?

    Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

  • What's the typical salary for Frontend Engineer in Singapore?

    Compensation for Frontend Engineer roles in Singapore varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Frontend Engineer hub for Singapore medians across recent openings.

  • How fast does AI Applyd auto-apply?

    Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

  • What ATS does Activate Interactive Pte Ltd use?

    AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, LinkedIn Easy Apply, and most other ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.