Skip to content

Sr Software Engineer

Altera Digital Health

Pune, INonsitePosted May 29, 2026

At a glance

Why this role might suit you

The role provides exposure to large‑scale health‑IT solutions, modern .NET and Azure technologies, and collaborative Agile development within a specialized domain.

Skills

cangularjavascripttypescripthtmlcsssqlt-sqlpl-sqlrestful-apiazure-devopsgithub-actionsgitgithubci-cdsecure-codingobject-oriented-programmingagile-scrum

About the role

About Altera :

Altera, a member of the N. Harris Computer Corporation family, delivers health IT solutions that support caregivers around the world. These include the Sunrise™, Paragon®, Altera TouchWorks®, Altera Opal, STAR™, HealthQuest™ and dbMotion™ solutions. At the intersection of technology and the human experience, Altera Digital Health is driving a new era of healthcare, in which innovation and expertise can elevate care delivery and inspire healthier communities across the globe. A new age in healthcare technology has just begun.

Job Title: Sr Software Engineer

This purpose of this role is to support Altera Canada in implementing Sunrise and other solutions including Altera Patient Flow and dbMotion. You’ll work alongside our project manager, implementation consultants, solution architects and other key resources with the goal of successfully rolling out Canadian centric solutions.

Role Summary

We are seeking an Sr Software Engineer to design, develop, and maintain scalable software solutions that support business, operational, and product needs. This role is intended for a strong hands-on developer who can build reliable applications, integrate systems, work with APIs and databases, and contribute to modern engineering practices.

While experience with data analytics, reporting, visualization, ETL, Power BI, Python, or predictive analytics is valuable, this role is first and foremost a software engineering position . The ideal candidate will bring strong development fundamentals and may also have experience supporting data-driven applications, dashboards, or analytical workflows.

Required Experience

4-7 years of experience in software development or application development

Strong hands-on experience developing, testing, and maintaining software applications

Experience with modern programming languages such as C#, .NET, JavaScript/TypeScript, Angular, or similar technologies

Strong understanding of object-oriented programming principles

Experience designing and consuming RESTful APIs

Experience working with relational databases and writing complex SQL queries

Experience with source control and collaborative development using tools such as Git, Azure DevOps, or GitHub

Understanding of software development lifecycle practices, including requirements analysis, design, development, testing, deployment, and support

Experience working in Agile/Scrum environments

Strong troubleshooting, problem-solving, and analytical skills

Excellent written and verbal communication skills

Required Technical Skills

Application development using .NET/C# or comparable enterprise technologies

Front-end or web application development using Angular, React, JavaScript, TypeScript, HTML, and CSS , or similar tools

Database development using SQL, T-SQL, PL/SQL, or equivalent

API development and integration

Debugging, code review, and performance optimization

Secure coding practices and data access control

CI/CD and deployment practices using Azure DevOps, GitHub Actions, or similar platforms

Preferred Qualifications

Experience with Microsoft Azure , including App Services, Azure Functions, Azure SQL, Azure Storage, or related services

Experience with DevOps practices, automated builds, releases, and deployment pipelines

Experience with containerization or cloud-native development

Experience integrating applications with external systems using REST APIs or other integration patterns

Experience supporting healthcare, enterprise, or business-critical applications

Familiarity with microservices, event-driven systems, or distributed application design

Experience with AI-assisted development tools such as GitHub Copilot

Familiarity with Generative AI concepts such as LLMs, prompt engineering, RAG, agents, MCP, or Azure OpenAI

Nice to Have

Experience with Power BI dashboard and report development

Experience with data modeling, data marts, semantic models, or OLAP concepts

Experience with ETL development using SSIS, Azure Data Factory, or similar platforms

Experience with Power Query, DAX, Power Pivot, or Power BI administration

Experience with forecasting, trend analysis, anomaly detection, or predictive analytics

Experience with Python or R for analytics, automation, or machine learning

Experience with Azure Data Services, Azure Machine Learning, Synapse Analytics, Snowflake, or similar platforms

Experience embedding reports, dashboards, or analytics into applications

Experience with Power Apps, Power Automate, Dataverse, or Power Platform governance

Experience using LLMs to generate summaries, insights, or dynamic narratives in reports or applications

Responsibilities

Design, develop, test, and maintain software applications and integrations

Build scalable, secure, and maintainable application components

Develop and integrate APIs, services, and database-driven functionality

Collaborate with product, data, business, and technical teams to translate requirements into working solutions

Participate in code reviews, technical design discussions, and engineering best practices

Troubleshoot application issues and optimize performance, reliability, and maintainability

Support CI/CD, deployment, and release management activities

Contribute to secure development practices and data access controls

Where applicable, support dashboard, reporting, analytics, or data integration needs as part of broader application delivery

Explore opportunities to use AI and automation to improve development productivity and solution quality

TRAVEL

Minimal travel as required for position responsibilities – less than 10%, depending on candidate location.

WORK ARRANGEMENTS

This candidate will work from a home office when not at client site

Questions about this role

  • How do I apply to this Sr Software Engineer role at Altera Digital Health?

    Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

  • What's the typical salary for Software Engineer in India?

    Compensation for Software Engineer roles in India varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Software Engineer hub for India medians across recent openings.

  • How fast does AI Applyd auto-apply?

    Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

  • What ATS does Altera Digital Health use?

    AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, LinkedIn Easy Apply, and most other ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.