Senior Cloud Security Architect

bmo

Dallas, USonsite$122k-$228k/yrPosted May 27, 2026
Posting intelligenceActively listedReposted 18×, possible evergreen/ghost posting

At a glance

Highlights

  • Onsite in Dallas or Chicago
  • Competitive salary range
  • Focus on AI and Agentic AI security

Heads up

  • Commission structure may apply

Why this role might suit you

The role offers a senior‑level opportunity to shape cloud security architecture across AWS, Azure, and GCP, with a strong emphasis on emerging AI security, CSPM/CNAPP strategy, and Zero Trust principles, backed by a competitive compensation package.

Skills

awsazuregcpcspmcnappiamciemkmsvpcencryptionloggingmonitoringkubernetescontainersserverlesswizprismadefendercisnistcsamitreai-rmfowasp-llm

About the role

Application Deadline:

06/29/2026

Address: 200 Crescent Court

Job Family Group: Technology

Lead the design and maturity of end-to-end cloud security across multi-cloud environments (AWS, Azure, GCP), with responsibility spanning core cyber domains, CSPM/CNAPP strategy, and emerging AI/Agentic AI security. Drive enterprise-wide security improvements through architecture, governance, and cross-functional engagement. Leads and facilitates the design and implementation of repeatable technical solutions and processes related to technology architecture. Defines and documents efficient and transparent architecture principles, standards and guidelines regarding the proper use and deployment of business applications, data and technology within the Bank. Partners with broader stakeholders in technology and business in defining architecture possibilities and futures. Works with business and development teams in recommending process or system design and enhancements. Ensures that systems are functionally appropriate, technically sound and well-integrated. Provides immediate response to critical production program-wide problems to evaluate solutions, coordinate recovery and ensure resolution.

Core Accountability

Own secure cloud architecture aligned to Zero Trust principles

Act as enterprise SME across all cyber domains, driving engagement and measurable improvements

Integrate security into platform, infrastructure, and AI adoption strategies

Balance risk, scalability, and operational effectiveness

Domain Expertise (All Cloud Security Pillars)

Identity & Access Management (IAM / CIEM) – least privilege, identity governance

Data Security – encryption, key management, data protection

Network Security – segmentation, private access, WAF, DDoS

Workload Security – VMs, containers, Kubernetes, serverless

Cloud Posture (CSPM/CNAPP) – misconfigurations, compliance, risk visibility

CSPM / CNAPP

Define and mature CSPM/CNAPP platform strategy across multi-cloud

Establish policy frameworks, risk prioritization, and control standards

Drive holistic visibility across assets, identities, workloads, and data

Integrate posture insights into risk management, operations, and governance

Improve signal-to-noise and remediation effectiveness at scale

AI & Agentic AI Security

Define secure architecture patterns for AI and Agentic AI workloads

Establish guardrails for AI service usage and autonomous workflows

Ensure secure integration with enterprise identity, data, and cloud platforms

Drive governance, accountability, and risk visibility across AI adoption

Qualifications:

Bachelor’s degree in Computer Science, Cybersecurity, or relevant field

7+ years specifically in cloud security with multi-domain architecture experience

Expertise across AWS, Azure, and/or GCP security

Experience with CSPM/CNAPP platforms (Wiz, Prisma, Defender, etc.)

Experience with AI/ML platforms and cloud-based AI services

Strong understanding of cloud security frameworks and standards (CIS, NIST, CSA, MITRE, AI RMF, OWASP LLM

Expert in cloud-native security controls (IAM, KMS, VPC security, encryption, logging, and monitoring).

Strong communication and collaboration skills, with a proven ability to influence stakeholders.

Salary:

$122,400.00 - $228,000.00

Pay Type: Salaried

The above represents BMO Financial Group’s pay range and type.

Salaries will vary based on factors such as location, skills, experience, education, and qualifications for the role, and may include a commission structure. Salaries for part-time roles will be pro-rated based on number of hours regularly worked. For commission roles, the salary listed above represents BMO Financial Group’s expected target for the first year in this position.

BMO Financial Group’s total compensation package will vary based on the pay type of the position and may include performance-based incentives, discretionary bonuses, as well as other perks and rewards. BMO also offers health insurance, tuition reimbursement, accident and life insurance, and retirement savings plans. To details of our benefits, please visit: https://jobs.bmo.com/global/en/Total-Rewards

Compensation

This Security Engineer role pays $122k-$228k/yr. Within typical range for security engineer roles in United States.

Questions about this role

Click "Apply with AI Applyd" above. We auto-fill the application from your resume and answer screening questions in seconds. No copy and paste, no juggling tabs.

Compensation for Security Engineer roles in United States varies widely by seniority, employer size, and remote vs onsite arrangement. Check the salary range on this listing when published, or browse our Security Engineer hub for United States medians across recent openings.

Most applications complete in under 90 seconds. You can track the status in your dashboard and watch the screenshot proof land the moment the application submits.

AI Applyd supports Greenhouse, Lever, Ashby, Workday, iCIMS, SmartRecruiters, Personio, Teamtailor and other major ATS platforms. If we can submit through the platform, we do.

Want AI Applyd to auto-apply to roles like this?

We tailor your resume per posting, fill the forms, and track replies for you.